2. GPCR/G Protein
  3. Amylin Receptor
  4. Pramlintide

Pramlintide is a polypeptide analogue of human amylin. Pramlintide, an antidiabetic agent, is antineoplastic in colorectal cancer.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Pramlintide Chemical Structure

Pramlintide Chemical Structure

CAS No. : 151126-32-8

Size Price Stock Quantity
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Pramlintide:

Pramlintide Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Pramlintide is a polypeptide analogue of human amylin. Pramlintide, an antidiabetic agent, is antineoplastic in colorectal cancer[1].

In Vitro

Pramlintide inhibits the growth of HCT-116 and HT-29 in a dose-dependent manner, with higher efficacy against the latter (IC50s of 48.67 and 9.10 μg/mL, respectively)[1].
The addition of 5, 10, and 20 μg/mL of Pramlintide to HCT-116 and HT-29 with 5-fluorouracil, Oxaliplatin, or Irinotecan induces the antiproliferative effect synergistically[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Pramlintide Related Antibodies
Clinical Trial
Molecular Weight

3949.39

Formula

C171H267N51O53S2
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7)
Sequence Shortening

KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (25.32 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2532 mL 1.2660 mL 2.5320 mL
5 mM 0.0506 mL 0.2532 mL 0.5064 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2532 mL 1.2660 mL 2.5320 mL 6.3301 mL
5 mM 0.0506 mL 0.2532 mL 0.5064 mL 1.2660 mL
10 mM 0.0253 mL 0.1266 mL 0.2532 mL 0.6330 mL
15 mM 0.0169 mL 0.0844 mL 0.1688 mL 0.4220 mL
20 mM 0.0127 mL 0.0633 mL 0.1266 mL 0.3165 mL
25 mM 0.0101 mL 0.0506 mL 0.1013 mL 0.2532 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Pramlintide Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Pramlintide151126-32-8Amylin ReceptorAMYRamylinantidiabeticantineoplasticcolorectalcancerInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pramlintide
Cat. No.:
HY-P0058
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.