1. Membrane Transporter/Ion Channel Apoptosis
  2. Sodium Channel Apoptosis
  3. Psalmotoxin 1 TFA

Psalmotoxin 1 TFA  (Synonyms: PcTx1 TFA; Psalmopoeus cambridgei toxin-1 TFA)

Cat. No.: HY-P1411A Purity: 99.37%
Handling Instructions Technical Support

Psalmotoxin 1 (PcTx1) TFA is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 TFA is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H+ of ASIC1a. Psalmotoxin 1 TFA can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 TFA can be used in the research of cancers, or neurological disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Psalmotoxin 1 TFA Chemical Structure

Psalmotoxin 1 TFA Chemical Structure

Size Price Stock Quantity
500 μg Get quote
1 mg In-stock
5 mg   Get quote  
10 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 5 publication(s) in Google Scholar

Other Forms of Psalmotoxin 1 TFA:

Top Publications Citing Use of Products

View All Sodium Channel Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Psalmotoxin 1 (PcTx1) TFA is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 TFA is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H+ of ASIC1a. Psalmotoxin 1 TFA can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 TFA can be used in the research of cancers, or neurological disease[1][3][4][6].

In Vitro

Psalmotoxin 1 (20 nM, 125 s) TFA inhibits ASIC1a currents by drastically shifting the steady-state desensitization curve to lower H+ concentrations[1].
Psalmotoxin 1 (30 nM) TFA competes with Ca2+ in binding to ASIC1a channels[1].
Psalmotoxin 1 (100 or 200 ng, 24-72 h) TFA significantly weakens the migration, proliferation and invasion of MCF-7 and MDA-MB-231 cells[4].
Psalmotoxin 1 (100 ng/mL, 24 h) TFA significantly inhibits acid-induced increases in intracellular calcium and LDH release, induces cell apoptosis and cell cycle arrest in nucleus pulposus cells (NPCs)[5].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Proliferation Assay[4]

Cell Line: MCF-7 and MDA-MB-231 cells
Concentration: 100 or 200 ng
Incubation Time: 24, 48, 72 h
Result: Inhibited the cell migration, proliferation and invasion of breast cancer cells.

Western Blot Analysis[5]

Cell Line: Nucleus pulposus cells (NPCs)
Concentration: 100 ng/mL
Incubation Time: 24 h
Result: Decreased Bax and cleaved caspase-3 expression, and increased Bcl-2 expression.
In Vivo

Psalmotoxin 1 (i.c.v., 1 ng/kg, a single dose) TFA is neuroprotective in a conscious model of stroke via direct inhibition of ASIC1a[2].
Psalmotoxin 1 (tail vein injection, 10 ng/kg, daily for 7 days) TFA inhibits tumor growth in breast cancer mice model[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male spontaneously hypertensive rats (SHR)[2]
Dosage: 1 ng/kg, a single dose.
Administration: Intracerebroventricular (i.c.v.) injection
Result: Reduced cortical and striatal infarct volumes measured 72 h post-stroke.
Reduced the severity of motor deficit at 1 and 3 days after stroke compared to control rats.
Displayed an anti-apoptotic effect in the occluded hemisphere (reduced stroke-induced caspase-3 positive cells).
Animal Model: Female nude BALB/C mice (orthotopic implantation, MCF-7 and MDA-MB-231 cells)[3]
Dosage: 10 ng/kg, daily for 7 days.
Administration: Tail vein injection
Result: Inhibited breast tumor growth.
Molecular Weight

4689.39 (free base)

Formula

C200H312N62O57S6.xC2HF3O2

Appearance

Solid

Color

White to off-white

Sequence

Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)

Sequence Shortening

EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Psalmotoxin 1 TFA
Cat. No.:
HY-P1411A
Quantity:
MCE Japan Authorized Agent: