2. Membrane Transporter/Ion Channel Apoptosis
  3. Sodium Channel Apoptosis
  4. Psalmotoxin 1

Psalmotoxin 1  (Synonyms: PcTx1; Psalmopoeus cambridgei toxin-1)

Cat. No.: HY-P1411 Purity: ≥99.0%
COA Handling Instructions

Molarity Calculator

Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H+ of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease.

For research use only. We do not sell to patients.

Psalmotoxin 1 Chemical Structure

Psalmotoxin 1 Chemical Structure

CAS No. : 880107-52-8

Size Price Stock Quantity
100 μg USD 700 In-stock

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Psalmotoxin 1:

Psalmotoxin 1 Related Antibodies

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Psalmotoxin 1

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H+ of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease[1][3][4][6].

IC50 & Target

IC50: 0.9 nM (ASIC1a), 50 nM (ASIC1b, ASIC2a, and ASIC3)[6].
In Vitro

Psalmotoxin 1 (20 nM, 125 s) inhibits ASIC1a currents by drastically shifting the steady-state desensitization curve to lower H+ concentrations[1].
? Psalmotoxin 1 (30 nM) competes with Ca2+ in binding to ASIC1a channels[1].
? Psalmotoxin 1 (100 or 200 ng, 24-72 h) significantly weakens the migration, proliferation and invasion of MCF-7 and MDA-MB-231 cells[4].
? Psalmotoxin 1 (100 ng/mL, 24 h) significantly inhibits acid-induced increases in intracellular calcium and LDH release, induces cell apoptosis and cell cycle arrest in nucleus pulposus cells (NPCs)[5].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Psalmotoxin 1 Related Antibodies

Cell Proliferation Assay[4]

Cell Line: MCF-7 and MDA-MB-231 cells
Concentration: 100 or 200 ng
Incubation Time: 24, 48, 72 h
Result: Inhibited the cell migration, proliferation and invasion of breast cancer cells.

Western Blot Analysis[5]

Cell Line: Nucleus pulposus cells (NPCs)
Concentration: 100 ng/mL
Incubation Time: 24 h
Result: Decreased Bax and cleaved caspase-3 expression, and increased Bcl-2 expression.
In Vivo

Psalmotoxin 1 (i.c.v., 1 ng/kg, a single dose) is neuroprotective in a conscious model of stroke via direct inhibition of ASIC1a[2].
? Psalmotoxin 1 (tail vein injection, 10 ng/kg, daily for 7 days) inhibits tumor growth in breast cancer mice model[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male spontaneously hypertensive rats (SHR)[2]
Dosage: 1 ng/kg, a single dose.
Administration: Intracerebroventricular (i.c.v.) injection
Result: Reduced cortical and striatal infarct volumes measured 72 h post-stroke.
Reduced the severity of motor deficit at 1 and 3 days after stroke compared to control rats.
Displayed an anti-apoptotic effect in the occluded hemisphere (reduced stroke-induced caspase-3 positive cells).
Animal Model: Female nude BALB/C mice (orthotopic implantation, MCF-7 and MDA-MB-231 cells)[3]
Dosage: 10 ng/kg, daily for 7 days.
Administration: Tail vein injection
Result: Inhibited breast tumor growth.
Molecular Weight

4689.39

Formula

C200H312N62O57S6
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)
Sequence Shortening

EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)
SMILES

O=C([C@@H](N)CCC(O)=O)N[C@H](C(N[C@H](C(N[C@H](C(N1[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H]2CSSC[C@H](NC3=O)C(N[C@H](C(N4[C@H](C(N[C@H](C(N[C@H](C(N5[C@H](C(N[C@H](C(N[C@H](C(O)=O)[C@@H](C)O)=O)CCCCN)=O)CCC5)=O)[C@@H](C)O)=O)CCCCN)=O)CCC4)=O)C(C)C)=O)=O)CC(O)=O)=O)=O)CC6=CNC=N6)=O)CCCNC(N)=N)=O)CC(N)=O)=O)C(C)C)=O)CSSC[C@H](NC7=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H]3C(C)C)=O)CCC(O)=O)=O)CC8=CC=CC=C8)=O)CO)=O)CCCNC(N)=N)=O)CCCNC(N)=N)=O)CCCNC(N)=N)=O)CCCCN)=O)CC9=CNC%10=CC=CC=C9%10)=O)=O)=O)CCCCN)=O)CC%11=CNC%12=CC=CC=C%11%12)=O)CCCCN)=O)CCC1)=O)[C@H](CC)C)=O)CSSC[C@H](NC2=O)C(N[C@H](C(NCC(N[C@H](C(N[C@H]7CCC(O)=O)=O)CC(C)C)=O)=O)CCC(O)=O)=O)=O)CC(O)=O
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation

Purity: ≥99.0%

COA (260 KB)

Handling Instructions (2659 KB)
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Psalmotoxin 1 Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Psalmotoxin 1880107-52-8PcTx1 Psalmopoeus cambridgei toxin-1Psalmotoxin1Psalmotoxin-1PcTx 1PcTx-1Psalmopoeus cambridgei toxin1Psalmopoeus cambridgei toxin 1Psalmopoeus cambridgei toxin-1Sodium ChannelApoptosisNa channelsNa+ channelsSpider toxinhypertensiveneuroprotectionbreast cancerMDA-MB-231MCF-7NPCsapoptosisInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Psalmotoxin 1
Cat. No.:
HY-P1411
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.