PSM-β 

PSM-β is a active peptide , which can be isolated from Staphylococcus epidermidis. PSM-β is an analog of staphylococcal toxins, as well as a termed phenol-soluble modulin. PSM-β has bacteriostatic and poorly hemolytic properties^[1][2].

4639.28

C₂₀₈H₃₃₈N₅₂O₆₅S

Solid

White to off-white

Met-Ser-Lys-Leu-Ala-Glu-Ala-Ile-Ala-Asn-Thr-Val-Lys-Ala-Ala-Gln-Asp-Gln-Asp-Trp-Thr-Lys-Leu-Gly-Thr-Ser-Ile-Val-Asp-Ile-Val-Glu-Ser-Gly-Val-Ser-Val-Leu-Gly-Lys-Ile-Phe-Gly-Phe

MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture and light, under nitrogen

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

• [1]. Mehlin C, et al. An inflammatory polypeptide complex from Staphylococcus epidermidis: isolation and characterization. J Exp Med. 1999 Mar 15;189(6):907-18.  [Content Brief]

  [2]. Marchand A, et al. Anti-Legionella activity of staphylococcal hemolytic peptides. Peptides. 2011 May;32(5):845-51.  [Content Brief]