1. Recombinant Proteins
  2. Others
  3. 14-3-3 beta Protein, Human (His)

14-3-3 beta protein, functioning as an adapter, regulates diverse signaling pathways by recognizing phosphoserine or phosphothreonine motifs and modulating partner activity. It acts as a negative regulator in osteogenesis, inhibiting SRPK2's nuclear translocation and preventing neuronal apoptosis. Additionally, it negatively regulates MAP kinase-activating cascades through AKAP13. As a homodimer, it interacts with various proteins, emphasizing its diverse roles in cellular processes and signaling pathways. 14-3-3 beta Protein, Human (His) is the recombinant human-derived 14-3-3 beta protein, expressed by E. coli, with N-6*His labeled tag. The total length of 14-3-3 beta Protein, Human (His) is 246 a.a., with molecular weight of ~29 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

14-3-3 beta protein, functioning as an adapter, regulates diverse signaling pathways by recognizing phosphoserine or phosphothreonine motifs and modulating partner activity. It acts as a negative regulator in osteogenesis, inhibiting SRPK2's nuclear translocation and preventing neuronal apoptosis. Additionally, it negatively regulates MAP kinase-activating cascades through AKAP13. As a homodimer, it interacts with various proteins, emphasizing its diverse roles in cellular processes and signaling pathways. 14-3-3 beta Protein, Human (His) is the recombinant human-derived 14-3-3 beta protein, expressed by E. coli, with N-6*His labeled tag. The total length of 14-3-3 beta Protein, Human (His) is 246 a.a., with molecular weight of ~29 kDa.

Background

The 14-3-3 beta protein serves as an adapter implicated in the regulation of a wide spectrum of both general and specialized signaling pathways. Recognizing phosphoserine or phosphothreonine motifs, it binds to numerous partners, modulating the activity of the binding partner upon interaction. It acts as a negative regulator of osteogenesis by blocking the nuclear translocation of the phosphorylated form of SRPK2, counteracting its stimulatory effect on cyclin D1 expression, and thereby preventing neuronal apoptosis induced by SRPK2. Additionally, 14-3-3 beta negatively regulates signaling cascades that activate MAP kinases through AKAP13. Existing as a homodimer, it interacts with various proteins, including SAMSN1, PRKCE, AKAP13, SSH1, TORC2/CRTC2, ABL1, ROR2, GAB2, YAP1, SRPK2, PKA-phosphorylated AANAT, MYO1C, SIRT2, DAPK2, PI4KB, TBC1D22A, TBC1D22B, SOS1, YWHAB, SLITRK1, SYNPO2, RIPOR2, MARK2, MARK3, TESK1, MEFV, HDAC4, and ADAM22. These interactions highlight the diverse roles of 14-3-3 beta in various cellular processes and signaling pathways.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P31946 (M1-N246)

Gene ID
Molecular Construction
N-term
6*His
14-3-3β (M1-N246)
Accession # P31946
C-term
Synonyms
KCIP-1; 14-3-3 protein beta/alpha; GW128; Protein 1054; YWHAB
AA Sequence

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Weight

Approximately 29 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

14-3-3 beta Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
14-3-3 beta Protein, Human (His)
Cat. No.:
HY-P700304
Quantity:
MCE Japan Authorized Agent: