14-3-3 sigma Protein, Mouse

14-3-3 sigma protein, an adapter in diverse signaling pathways, binds phosphoserine or phosphothreonine motifs, modulating partner activity. It regulates protein synthesis and cell growth via Akt/mTOR pathway stimulation when bound to KRT17. It may also regulate MDM2 autoubiquitination, activating p53/TP53. Existing as a homodimer, it interacts with GAB2, KRT17, SAMSN1, SRPK2, COPS6, COP1 (for degradation), phosphorylated DAPK2, PI4KB, SLITRK1, and LRRK2 (phosphorylation-dependent). Complexes include XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, and VPS35. 14-3-3 sigma Protein, Mouse is the recombinant mouse-derived 14-3-3 sigma protein, expressed by E. coli, with tag free. The total length of 14-3-3 sigma Protein, Mouse is 248 a.a., with molecular weight of ~32 kDa.

The 14-3-3 sigma protein functions as an adapter implicated in the regulation of a broad spectrum of both general and specialized signaling pathways, engaging with numerous partners through the recognition of phosphoserine or phosphothreonine motifs, thereby modulating the activity of the binding partner. Particularly, when bound to KRT17, it plays a role in regulating protein synthesis and epithelial cell growth by stimulating the Akt/mTOR pathway. Additionally, it may regulate MDM2 autoubiquitination and degradation, leading to the activation of p53/TP53. Existing as a homodimer, 14-3-3 sigma is found in a complex with XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, and VPS35, and it interacts with various proteins, including GAB2, KRT17, SAMSN1, SRPK2, COPS6, COP1 (leading to proteasomal degradation), the 'Thr-369' phosphorylated form of DAPK2, PI4KB, SLITRK1, and LRRK2 (dependent on LRRK2 phosphorylation). These diverse interactions highlight the versatile role of 14-3-3 sigma in orchestrating various cellular processes and signaling events.

Mouse

E. coli

Tag Free

O70456 (M1-S248)

55948  [NCBI]

MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGGEAPEEPQS

Approximately 32 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.