1. Recombinant Proteins
  2. Others
  3. 14-3-3 sigma Protein, Mouse

14-3-3 sigma protein, an adapter in diverse signaling pathways, binds phosphoserine or phosphothreonine motifs, modulating partner activity. It regulates protein synthesis and cell growth via Akt/mTOR pathway stimulation when bound to KRT17. It may also regulate MDM2 autoubiquitination, activating p53/TP53. Existing as a homodimer, it interacts with GAB2, KRT17, SAMSN1, SRPK2, COPS6, COP1 (for degradation), phosphorylated DAPK2, PI4KB, SLITRK1, and LRRK2 (phosphorylation-dependent). Complexes include XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, and VPS35. 14-3-3 sigma Protein, Mouse is the recombinant mouse-derived 14-3-3 sigma protein, expressed by E. coli, with tag free. The total length of 14-3-3 sigma Protein, Mouse is 248 a.a., with molecular weight of ~32 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

14-3-3 sigma protein, an adapter in diverse signaling pathways, binds phosphoserine or phosphothreonine motifs, modulating partner activity. It regulates protein synthesis and cell growth via Akt/mTOR pathway stimulation when bound to KRT17. It may also regulate MDM2 autoubiquitination, activating p53/TP53. Existing as a homodimer, it interacts with GAB2, KRT17, SAMSN1, SRPK2, COPS6, COP1 (for degradation), phosphorylated DAPK2, PI4KB, SLITRK1, and LRRK2 (phosphorylation-dependent). Complexes include XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, and VPS35. 14-3-3 sigma Protein, Mouse is the recombinant mouse-derived 14-3-3 sigma protein, expressed by E. coli, with tag free. The total length of 14-3-3 sigma Protein, Mouse is 248 a.a., with molecular weight of ~32 kDa.

Background

The 14-3-3 sigma protein functions as an adapter implicated in the regulation of a broad spectrum of both general and specialized signaling pathways, engaging with numerous partners through the recognition of phosphoserine or phosphothreonine motifs, thereby modulating the activity of the binding partner. Particularly, when bound to KRT17, it plays a role in regulating protein synthesis and epithelial cell growth by stimulating the Akt/mTOR pathway. Additionally, it may regulate MDM2 autoubiquitination and degradation, leading to the activation of p53/TP53. Existing as a homodimer, 14-3-3 sigma is found in a complex with XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, and VPS35, and it interacts with various proteins, including GAB2, KRT17, SAMSN1, SRPK2, COPS6, COP1 (leading to proteasomal degradation), the 'Thr-369' phosphorylated form of DAPK2, PI4KB, SLITRK1, and LRRK2 (dependent on LRRK2 phosphorylation). These diverse interactions highlight the versatile role of 14-3-3 sigma in orchestrating various cellular processes and signaling events.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

O70456 (M1-S248)

Gene ID
Molecular Construction
N-term
14-3-3σ (M1-S248)
Accession # O70456
C-term
Synonyms
14-3-3 protein sigma; HME1; SFN; Stratifin; Mkrn3
AA Sequence

MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGGEAPEEPQS

Molecular Weight

Approximately 32 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

14-3-3 sigma Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
14-3-3 sigma Protein, Mouse
Cat. No.:
HY-P74438
Quantity:
MCE Japan Authorized Agent: