4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc)

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8(+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

4-1BB/TNFRSF9 Protein, functioning as the receptor for TNFSF9/4-1BBL, plays a pivotal role in conveying signals that augment CD8(+) T-cell survival, cytotoxicity, and mitochondrial activity, thereby contributing to enhanced immunity against viruses and tumors. It predominantly exists as a homodimeric structure, with the possibility of monomeric states. The association with key signaling molecules, including p56-LCK and interactions with TRAF1, TRAF2, and TRAF3, underscores its importance in mediating intracellular pathways essential for promoting immune responses and regulatory functions.

4-1BB (hamster ovary; 5 μg/mL; 16 h) costimulates B lymphocyte proliferation^[4].

Measured by its ability to block 4-1BBL-induced IL-2 secretion by mouse CTLL-2 cells. The ED₅₀ for this effect is 0.603 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 1.66×10^3 U/mg.

• 
  Measured by its ability to block 4-1BBL-induced IL-2 secretion by mouse CTLL-2 cells. The ED₅₀ for this effect is 0.603 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 1.66×10³ U/mg.

Mouse

HEK293

C-hFc

P20334 (V24-L187)

21942  [NCBI]

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

approximately 58.72 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.