Adenylate Kinase 1/AK1 Protein, Rat (His)

The adenylate kinase 1 (AK1) protein plays a crucial role in cellular energy homeostasis by maintaining the balance of adenylate nucleotides by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP.Adenylate Kinase 1/AK1 Protein, Rat (His) is the recombinant rat-derived Adenylate Kinase 1/AK1 protein, expressed by E.coli , with N-His labeled tag.

Adenylate Kinase 1 (AK1) is a versatile enzyme that catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP, a critical step in cellular energy homeostasis. Additionally, AK1 exhibits nucleoside diphosphate kinase activity, facilitating the production of various nucleoside triphosphates (ATP, CTP, GTP, UTP, dATP, dCTP, dGTP, and dTTP) from their corresponding diphosphate substrates, using either ATP or GTP as a phosphate donor. This enzymatic flexibility highlights its essential role in nucleotide biosynthesis. Furthermore, AK1 demonstrates a lower-rate catalysis of the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP, indicating its involvement in thiamine metabolism. The multifaceted functions of AK1 underscore its importance in maintaining cellular energy levels and participating in diverse nucleotide and cofactor biosynthetic pathways.

Specific activity is 933.598 units/mg. One unit will convert ATP + AMP to 2.0 µmoles of ADP per minute at pH 7.5 at 37 °C.

Rat

E. coli

N-6*His

P39069 (M1-K194)

24183  [NCBI]

MEDKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSSRGKMLSSIMEKGELVPLETVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVISFYDKRGIVRKVNAEGSVDTVFSQVCTYLDSLK

Approximately 23 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of PBS, 100 mM arginine, pH 7.1, 20% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.