AG-2 Protein, Human (HEK293, His)

AG-2 protein is critical for MUC2 post-transcriptional synthesis and secretion, implicating its role in intestinal mucus production. As a proto-oncogene, AG-2 affects cell migration, differentiation, and growth. AG-2 Protein, Human (HEK293, His) is the recombinant human-derived AG-2 protein, expressed by HEK293 , with C-10*His labeled tag.

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, suggesting a potential involvement in mucus production by intestinal cells. Beyond its role in mucin regulation, AG-2 emerges as a proto-oncogene, exerting influence on cell migration, differentiation, and growth. Notably, AG-2 promotes cell adhesion, underscoring its multifaceted contributions to cellular processes. Structurally, AG-2 exists as both a monomer and a homodimer. Additionally, it interacts with LYPD3 and DAG1 (alphaDAG1), forming complexes that may further modulate its functions. The interaction with MUC2, characterized by disulfide linkages, highlights the intricate molecular relationships AG-2 establishes within the cellular milieu.

Measured by the ability of the immobilized protein to support the adhesion of PC-3 human prostate cancer cells. The ED₅₀ for this effect is 1.963 μg/mL, corresponding to a specific activity is 509.424 units/mg.

• 
  Measured by the ability of the immobilized protein to support the adhesion of PC-3 human prostate cancer cells.  The ED₅₀ for this effect is 1.963 μg/mL， corresponding to a specific activity is 509.424 units/mg.

Human

HEK293

C-10*His

O95994 (R21-L175)

10551  [NCBI]

RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

Approximately 20 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.