1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Serine/Threonine Kinase Proteins
  4. AKT Serine/Threonine Kinase 3 (AKT3)
  5. AKT3 Protein, Mouse (sf9)

The AKT3 protein is part of the AKT kinase family and regulates a variety of cellular processes, including metabolism, proliferation, and survival.Its least-studied isoform, AKT3, is critical for brain development and is critical for the viability of malignant glioma cells.AKT3 Protein, Mouse (sf9) is the recombinant mouse-derived AKT3 protein, expressed by Sf9 insect cells , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The AKT3 protein is part of the AKT kinase family and regulates a variety of cellular processes, including metabolism, proliferation, and survival.Its least-studied isoform, AKT3, is critical for brain development and is critical for the viability of malignant glioma cells.AKT3 Protein, Mouse (sf9) is the recombinant mouse-derived AKT3 protein, expressed by Sf9 insect cells , with tag free.

Background

AKT3, a member of the AKT kinase family alongside AKT1 and AKT2, is a serine/threonine-protein kinase that orchestrates a myriad of essential cellular processes, including metabolism, proliferation, cell survival, growth, and angiogenesis. Its influence is exerted through the phosphorylation of numerous downstream substrates, with over 100 potential candidates identified, though most lack reported isoform specificity. Despite being the least studied isoform, AKT3 emerges as a pivotal player in brain development and proves indispensable for the viability of malignant glioma cells. Notably, it may serve as a central mediator in the up-regulation and down-regulation of MMP13 via IL13. Moreover, AKT3 plays a crucial role in coordinating mitochondrial biogenesis with heightened cellular energy demands triggered by growth factors. Silencing AKT3 expression through RNA interference down-regulates the phosphorylated form of BAD, culminating in the induction of caspase-dependent apoptosis, underscoring its multifaceted and significant regulatory functions.

Species

Mouse

Source

Sf9 insect cells

Tag

Tag Free

Accession

Q9WUA6-1 (A106-E479)

Gene ID
Molecular Construction
N-term
AKT3 (A106-E479)
Accession # Q9WUA6-1
C-term
Synonyms
RAC-gamma serine/threonine-protein kinase; Protein kinase Akt-3; PKB gamma; Akt3
AA Sequence

ADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPHFPQFSYSASGRE

Molecular Weight

Approximately 46 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AKT3 Protein, Mouse (sf9)
Cat. No.:
HY-P72817
Quantity:
MCE Japan Authorized Agent: