AKT3 Protein, Mouse (sf9)

The AKT3 protein is part of the AKT kinase family and regulates a variety of cellular processes, including metabolism, proliferation, and survival.Its least-studied isoform, AKT3, is critical for brain development and is critical for the viability of malignant glioma cells.AKT3 Protein, Mouse (sf9) is the recombinant mouse-derived AKT3 protein, expressed by Sf9 insect cells , with tag free.

AKT3, a member of the AKT kinase family alongside AKT1 and AKT2, is a serine/threonine-protein kinase that orchestrates a myriad of essential cellular processes, including metabolism, proliferation, cell survival, growth, and angiogenesis. Its influence is exerted through the phosphorylation of numerous downstream substrates, with over 100 potential candidates identified, though most lack reported isoform specificity. Despite being the least studied isoform, AKT3 emerges as a pivotal player in brain development and proves indispensable for the viability of malignant glioma cells. Notably, it may serve as a central mediator in the up-regulation and down-regulation of MMP13 via IL13. Moreover, AKT3 plays a crucial role in coordinating mitochondrial biogenesis with heightened cellular energy demands triggered by growth factors. Silencing AKT3 expression through RNA interference down-regulates the phosphorylated form of BAD, culminating in the induction of caspase-dependent apoptosis, underscoring its multifaceted and significant regulatory functions.

Mouse

Sf9 insect cells

Tag Free

Q9WUA6-1 (A106-E479)

23797  [NCBI]

ADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPHFPQFSYSASGRE

Approximately 46 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.