1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Serine/Threonine Kinase Proteins
  4. Activin/Inhibins Receptor
  5. ALK-7
  6. ALK-7 Protein, Rhesus Macaque (HEK293, Fc)

ALK-7 is a type I receptor serine-threonine kinase mediate inhibitory as well as stimulatory signals for growth and differentiation by binding to members of the TGF-β superfamily. ALK-7 combined with specific ligands, such as Nodal, activin B and growth differentiation factor (GDF), can activate Smads and other signaling pathways, thereby regulating cell proliferation, differentiation and apoptosis in various cells. ALK-7 Protein, Rhesus Macaque (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 89 amino acids (G25-E113).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

ALK-7 Protein, Rhesus Macaque (HEK293, Fc) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

ALK-7 is a type I receptor serine-threonine kinase mediate inhibitory as well as stimulatory signals for growth and differentiation by binding to members of the TGF-β superfamily. ALK-7 combined with specific ligands, such as Nodal, activin B and growth differentiation factor (GDF), can activate Smads and other signaling pathways, thereby regulating cell proliferation, differentiation and apoptosis in various cells[1][2][3]. ALK-7 Protein, Rhesus Macaque (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 89 amino acids (G25-E113).

Background

ALK-7, also known as ACVR1C, is a serine/threonine kinase consistent with the characteristics of a type-I receptor. ALK-7 is predominantly expressed in central nervous system. ALK-7 can form complexes with type II receptor serine-threonine kinases for TGF-β and activin in a ligand-dependent manner[1].
The ALK-7 gene encodes a 55-kDa cell-surface protein that exhibits up to 78% amino acid sequence identity in the kinase domain to previously isolated type I receptors for TGF-β and activin. In the extracellular domain, however, ALK-7 is more divergent, displaying comparable similarities with all members of the ALK subfamily. Originally identified and cloned from rat brain, ALK-7 mRNA is present throughout the digestive and central nervous system of rats. The function of ALK-7 as a type I receptor was confirmed with a constitutively activemutant form that activated a TGF-β/activin response reporter. ALK-7 has also been found to activate some components of the Smad pathway, such as Smad2 and Smad3, in fetal and adult rat pancreas. In the rat pheochromocytoma PC12 cell line, ALK-7 not only activated both Smad2, Smad3, and the MAPK of extracellular signal-regulated kinase and JNK, but it inhibits cell proliferation as well. The human gene for ALK-7 has been mapped to the genetic location of 2q24.1-q3, with most of the mRNA located in the brain, pancreas, and colon. ALK-7 mediates high-ambient glucose-induced cardiomyoblasts apoptosis through the activation of Smad2/3[1][2][3].
ALK-7 combined with specific ligands, such as Nodal, activin B and growth differentiation factor (GDF), can activate Smads and other signaling pathways, thereby regulating cell proliferation, differentiation and apoptosis in various cells. Besides that, ALK-7, along with ALK-5 and ALK-6, participated in renal interstitial fibrosis[1][2][3].

In Vitro

Activin AB binds ActRIIA-Fc with a high affinity, whereas activin AB shows little binding to ALK7-Fc or ALK4-Fc (.5-5 μg). An estimated Kd of activin AB to ActRIIA-Fc is 333 pM. The affinity of activin AB for ActRIIA-Fc/ALK7-Fc is greater than that for ActRIIA-Fc and has an estimated Kd of 125 pM. This indicates the enhanced activin AB binding to the activin receptors in the presence of ALK7[5].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human ALK-7 is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Human Nodal (HY-P700025AF). The ED50 for this effect is 491.9 ng/mL.

Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

F7GDQ6 (G25-E113)

Gene ID
Molecular Construction
N-term
ALK-7 (G25-E113)
Accession # F7GDQ6
hFc
C-term
Synonyms
Activin receptor type IC; ACTR-IC; ACVRLK7; ALK7
AA Sequence

GLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME

Molecular Weight

Approximately 43-70 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ALK-7 Protein, Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P75573
Quantity:
MCE Japan Authorized Agent: