ALKAL1 Protein, Human (His, B2M)

ALKAL1 Protein, Human (His, B2M) is a potent activating ligand for human ALK that binds to the extracellular domain of ALK.

ALK and LTK ligand 1 (ALKAL1) also named “augmentor-β” or “FAM150A” is identified as a potent activating ligand for human ALK that bind to the extracellular domain of ALK. ALKAL1 is upregulated in colorectal cancer tissues and cell lines. Upregulation of ALKAL1 correlated with tumor malignancy and poor prognosis in colorectal cancer. ALKAL1 silencing inhibited tumorigenesis, metastasis and invasion of colorectal cancer cells, and inhibits SHH signaling pathway, which is essential for ALKAL1 induced migration. These findings reveal a new mechanism by which ALKAL1 participates in colorectal cancer migration and invasion via activating the SHH signaling pathway^[1].

Human

E. coli

N-6*His;N-B2M

Q6UXT8 (R28-T129)

389658  [NCBI]

RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT

Approximately 30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. V Van Deuren, et al. Structural determinants of nucleobase modification recognition in the AlkB family of dioxygenases. DNA Repair (Amst). 2020 Dec;96:102995.  [Content Brief]

  [2]. B J Chen, et al. The Escherichia coli AlkB protein protects human cells against alkylation-induced toxicity. J Bacteriol. 1994 Oct;176(20):6255-61.  [Content Brief]