1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Phosphatase
  4. Alkaline Phosphatase
  5. Alkaline Phosphatase/ALPI Protein, Human (HEK293, His)

Alkaline Phosphatase/ALPI Protein, Human (HEK293, His)

Cat. No.: HY-P72822
Handling Instructions Technical Support

ALPI Proteinas, an alkaline phosphatase, effectively hydrolyzes diverse phosphate compounds. Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) is the recombinant human-derived ALPI protein, expressed by HEK293 , with C-His labeled tag. The total length of ALPI Protein, Human (HEK293, His) is 484 a.a., with molecular weight of ~70-80 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ALPI Proteinas, an alkaline phosphatase, effectively hydrolyzes diverse phosphate compounds. Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) is the recombinant human-derived ALPI protein, expressed by HEK293 , with C-His labeled tag. The total length of ALPI Protein, Human (HEK293, His) is 484 a.a., with molecular weight of ~70-80 kDa.

Background

ALPI protein serves as an alkaline phosphatase with the capacity to hydrolyze various phosphate compounds.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate, 4-Methylumbelliferyl phosphat. The specific activity is 158755.391 pmol/min/µg, as measured under the described conditions.

  • Measured by its ability to cleave the fluorogenic peptide substrate, 4-Methylumbelliferyl phosphat. The specific activity is 158755.391 pmol/min/µg, as measured under the described conditions.
Species

Human

Source

HEK293

Tag

C-His

Accession

P09923 (V20-D503)

Gene ID

248  [NCBI]

Molecular Construction
N-term
ALPI (V20-D503)
Accession # P09923
His
C-term
Synonyms
Intestinal-type alkaline phosphatase; IAP; ALPI; Alkaline Phosphatase
AA Sequence

VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD

Molecular Weight

Approximately 70-80 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Alkaline Phosphatase/ALPI Protein, Human (HEK293, His)
Cat. No.:
HY-P72822
Quantity:
MCE Japan Authorized Agent: