ALPI Protein, Human (HEK293, His)

ALPI Proteinas, an alkaline phosphatase, effectively hydrolyzes diverse phosphate compounds. ALPI Protein, Human (HEK293, His) is the recombinant human-derived ALPI protein, expressed by HEK293 , with C-His labeled tag. The total length of ALPI Protein, Human (HEK293, His) is 484 a.a., with molecular weight of ~70-80 kDa.

ALPI protein serves as an alkaline phosphatase with the capacity to hydrolyze various phosphate compounds.

Measured by its ability to cleave the fluorogenic peptide substrate, 4-Methylumbelliferyl phosphat. The specific activity is 158755.391 pmol/min/µg, as measured under the described conditions.

• 
  Measured by its ability to cleave the fluorogenic peptide substrate, 4-Methylumbelliferyl phosphat. The specific activity is 158755.391 pmol/min/µg, as measured under the described conditions.

Human

HEK293

C-His

P09923 (V20-D503)

248  [NCBI]

VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD

Approximately 70-80 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.