Angiopoietin-1 Protein, Cynomolgus (HEK293, His)

The Angiopoietin-1 Protein is a secreted glycoprotein that is a key ligand in the vascular tyrosine kinase signaling pathway. ANGPT1 stimulates angiogenesis by activating PTK2/FAK and downstream kinase MAPK1/ERK2 and MAPK3/ERK1 signaling pathways. ANGPT1 affects the proliferation, migration and differentiation of skeletal muscle cells. Angiopoietin-1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Angiopoietin-1 protein, expressed by HEK293 , with N-His labeled tag.

ANGPT1 encodes a secreted glycoprotein in the angiopoietin family and is a key ligand in the vasotyrosine kinase signaling pathway. ANGPT1 stimulates angiogenesis by activating PTK2/FAK and downstream kinase MAPK1/ERK2 and MAPK3/ERK1 signaling pathways. The Angiopoietin-1 Protein regulates the formation and stability of blood vessels and plays an important role in vascular development. ANGPT1 affects the proliferation, migration and differentiation of skeletal muscle cells^[1][2][3].

Determined by its ability to induce adhesion of human umbilical vein endothelial cells (HUVEC).The ED₅₀ for this effect is 258.6 ng/mL, corresponding to a specific activity is 3.867×10³ units/mg.

• 
  Determined by its ability to induce adhesion of human umbilical vein endothelial cells (HUVEC).The ED₅₀ for this effect is 258.6 ng/mL, corresponding to a specific activity is 3.867×10³ units/mg.

Cynomolgus

HEK293

N-6*His

XP_005563980 (R276-F497)

102123994  [NCBI]

REEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

Approximately 30-34 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.