1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. ANG-1
  5. Angiopoietin-1 Protein, Mouse (HEK293, His)

Angiopoietin-1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P74412A
SDS COA Handling Instructions

Angiopoietin-1 (ANGPT1) is a secreted glycoprotein that belongs to the angiopoietin family. It actively regulates blood vessel formation and stabilization, playing a pivotal role in vascular development. ANGPT1 also influences skeletal myoblasts and orchestrates the vascular response to tissue injury. Its broad expression in various tissues highlights its significance in diverse physiological contexts. Angiopoietin-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-1 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $85 In-stock
50 μg $235 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Angiopoietin-1 (ANGPT1) is a secreted glycoprotein that belongs to the angiopoietin family. It actively regulates blood vessel formation and stabilization, playing a pivotal role in vascular development. ANGPT1 also influences skeletal myoblasts and orchestrates the vascular response to tissue injury. Its broad expression in various tissues highlights its significance in diverse physiological contexts. Angiopoietin-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-1 protein, expressed by HEK293 , with N-His labeled tag.

Background

Angiopoietin-1 (ANGPT1) encodes a secreted glycoprotein within the angiopoietin family of vascular growth factors. As a crucial ligand in the vascular tyrosine kinase signaling pathway, this protein actively regulates the formation and stabilization of blood vessels, demonstrating its pivotal role in vascular development. Beyond its vascular functions, ANGPT1 operates in striated muscles, influencing the proliferation, migration, and differentiation of skeletal myoblasts. Moreover, ANGPT1 plays a vital role in orchestrating the vascular response to tissue injury. The gene exhibits alternative splicing, resulting in multiple transcript variants. Its broad expression across various tissues, including the heart, lung, and other anatomical sites, underscores the significance of ANGPT1 in diverse physiological contexts.

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 223.9 ng/mL, corresponding to a specific activity is 4.466×10^3 units/mg.

  • Measured by the ability of the immobilized protein to support the adhesion of HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 223.9 ng/mL, corresponding to a specific activity is 4.466×103 units/mg.
Species

Mouse

Source

HEK293

Tag

N-6*His

Accession

NP_033770.2 (R277-F498)

Gene ID

11600

Molecular Construction
N-term
6*His
Angiopoietin-1 (R277-F498)
Accession # NP_033770.2
C-term
Synonyms
AGP1; AGPT; ANG-1; Angiopoietin-1; ANGPT1
AA Sequence

REEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

Molecular Weight

Approximately 29 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Angiopoietin-1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiopoietin-1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74412A
Quantity:
MCE Japan Authorized Agent: