1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. ANG-2
  5. Angiopoietin-2 Protein, Human (HEK293, Fc)

Angiopoietin-2 Protein, Human (HEK293, Fc)

Cat. No.: HY-P72827
Data Sheet Handling Instructions Technical Support

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (HEK293, Fc) is the recombinant human-derived Angiopoietin-2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Angiopoietin-2 Protein, Human (HEK293, Fc) is 478 a.a., with molecular weight of 110-115 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg USD 70 Ask For Quote & Lead Time
50 μg USD 200 Ask For Quote & Lead Time
100 μg USD 320 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (HEK293, Fc) is the recombinant human-derived Angiopoietin-2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Angiopoietin-2 Protein, Human (HEK293, Fc) is 478 a.a., with molecular weight of 110-115 kDa.

Background

The Angiopoietin-2 (ANGPT2) protein binds to TEK/TIE2, competing for the ANGPT1 binding site and thereby modulating ANGPT1 signaling. This interaction can induce the tyrosine phosphorylation of TEK/TIE2 even in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2's action leads to the loosening of cell-matrix contacts, potentially inducing endothelial cell apoptosis and consequent vascular regression. However, in the presence of VEGF, ANGPT2 collaborates to facilitate endothelial cell migration and proliferation, acting as a permissive angiogenic signal. Furthermore, ANGPT2 is involved in the regulation of lymphangiogenesis. The protein also interacts with TEK/TIE2, competing for the same binding site as ANGPT1, and additionally interacts with ITGA5, contributing to its multifaceted role in angiogenesis and vascular regulation.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

O15123-1 (Y19-F496)

Gene ID

285  [NCBI]

Molecular Construction
N-term
Angiopoietin-2 (Y19-F496)
Accession # O15123-1
hFc
C-term
Synonyms
Angiopoietin-2; ANG-2; ANGPT2
AA Sequence

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Weight

110-115 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Angiopoietin-2 Protein, Human (HEK293, Fc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiopoietin-2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72827
Quantity:
MCE Japan Authorized Agent: