Angiopoietin-4 Protein, Human (HEK293, Fc)

Angiopoietin 4 protein (ANGPT4) critically binds to TEK/TIE2, regulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation. In addition to regulation, ANGPT4 promotes endothelial cell survival, migration, and angiogenesis. Angiopoietin-4 Protein, Human (HEK293, Fc) is the recombinant human-derived Angiopoietin-4 protein, expressed by HEK293 , with N-hFc labeled tag.

The Angiopoietin-4 (ANGPT4) protein exhibits a pivotal role as it binds to TEK/TIE2, thereby modulating ANGPT1 signaling. Beyond its regulatory function, ANGPT4 has the capability to induce tyrosine phosphorylation of TEK/TIE2. Notably, it plays a crucial role in promoting endothelial cell survival, migration, and angiogenesis. Structurally, ANGPT4 exists as a homodimer, connected by disulfide linkages, highlighting its oligomeric nature. Its functional interactions with TEK/TIE2 further emphasize its integral role in orchestrating cellular processes essential for angiogenesis and vascular homeostasis.

Angiopoietin-4 acts as an angiogenic inhibitor, and it (50 ng/mL; 8 h, 24 h) reduces endothelial migration and tube formation in co-cultured HUVECs with transfected fibroblasts^[1].

Measured by its ability to compete with biotinylated rhAng-2 for binding to immobilized Tie-2 in a functional ELISA. When Recombinant Human Tie-2 Protein (HY-P72450) is immobilized at 5 µg/mL (100 µL/well), Recombinant Human Angiopoietin-4 binds with an ED₅₀ of 0.1030 μg/mL, in the presence of 5 µg/mL biotinylated rhAng-2 (HY-P72828).

• 
  Measured by its ability to compete with biotinylated rhAng-2 for binding to immobilized Tie-2 in a functional ELISA. When Recombinant Human Tie-2 Protein (HY-P72450) is immobilized at 5 µg/mL (100 µL/well), Recombinant Human Angiopoietin-4 binds with an ED₅₀ of 0.1030 μg/mL, in the presence of 5 µg/mL biotinylated rhAng-2 (HY-P72828).

Human

HEK293

N-hFc

Q9Y264-1 (M282-I503)

51378  [NCBI]

MAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRPLDI

Approximately 58-77 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Dittrich GM, et al. Fibroblast GATA-4 and GATA-6 promote myocardial adaptation to pressure overload by enhancing cardiac angiogenesis. Basic Res Cardiol. 2021 Apr 19;116(1):26.  [Content Brief]

  [2]. Wu Z, et al. Single-cell analysis reveals an Angpt4-initiated EPDC-EC-CM cellular coordination cascade during heart regeneration. Protein Cell. 2023 May 8;14(5):350-368.  [Content Brief]