1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. Angiopoietin-Like 7
  5. ANGPTL7/Angiopoietin-related 7 Protein, Rhesus Macaque (HEK293, His)

ANGPTL7/Angiopoietin-related 7 Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P75506
SDS COA Handling Instructions

ANGPTL7/angiopoietin-related 7 protein plays a crucial role in the formation and organization of the extracellular matrix. Particularly in the eye, it serves as a mediator for dexamethasone-induced matrix deposition within the trabecular meshwork, a tissue that studies have shown is necessary for aqueous humor outflow and maintenance of intraocular pressure. ANGPTL7/Angiopoietin-related 7 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived ANGPTL7/Angiopoietin-related 7 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ANGPTL7/angiopoietin-related 7 protein plays a crucial role in the formation and organization of the extracellular matrix. Particularly in the eye, it serves as a mediator for dexamethasone-induced matrix deposition within the trabecular meshwork, a tissue that studies have shown is necessary for aqueous humor outflow and maintenance of intraocular pressure. ANGPTL7/Angiopoietin-related 7 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived ANGPTL7/Angiopoietin-related 7 protein, expressed by HEK293 , with C-His labeled tag.

Background

The ANGPTL7/Angiopoietin-related 7 protein assumes a crucial role in the formation and organization of the extracellular matrix. Particularly in the eye, it acts as a mediator of dexamethasone-induced matrix deposition within the trabecular meshwork, a tissue essential for the outflow of ocular aqueous humor and the maintenance of intraocular pressure. Additionally, ANGPTL7 serves as a negative regulator of angiogenesis in the cornea, playing a significant role in preserving corneal avascularity and transparency, as suggested by research findings. Structurally, it forms a homotetramer through disulfide linkages, further emphasizing its role in maintaining the structural integrity of the extracellular matrix in ocular tissues.

Biological Activity

When Recombinant Human LILRB2 Protein is immobilized at 5 µg/mL (100 µL/well) can bind Biotinylated Rhesus Macaque ANGPTL7 Protein. The ED50 for this effect is 0.472 μg/mL.

  • When Recombinant Human LILRB2 Protein is immobilized at 5 µg/mL (100µL/well) can bind Biotinylated Rhesus Macaque ANGPTL7 Protein. The ED50 for this effect is 0.472 μg/mL.
Species

Rhesus Macaque

Source

HEK293

Tag

C-6*His

Accession

F7HQR6 (Q27-P344)

Gene ID
Molecular Construction
N-term
ANGPTL7 (Q27-P344)
Accession # F7HQR6
His
C-term
Synonyms
Angiopoietin like 7; ANGPTL7; CDT6
AA Sequence

QKPSKRKTPAQLKAATCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYQDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP

Molecular Weight

Approximately 31-35 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 6.5, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ANGPTL7/Angiopoietin-related 7 Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANGPTL7/Angiopoietin-related 7 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P75506
Quantity:
MCE Japan Authorized Agent: