ANGPTL7/Angiopoietin-related 7 Protein, Rhesus Macaque (HEK293, His)

ANGPTL7/angiopoietin-related 7 protein plays a crucial role in the formation and organization of the extracellular matrix. Particularly in the eye, it serves as a mediator for dexamethasone-induced matrix deposition within the trabecular meshwork, a tissue that studies have shown is necessary for aqueous humor outflow and maintenance of intraocular pressure. ANGPTL7/Angiopoietin-related 7 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived ANGPTL7/Angiopoietin-related 7 protein, expressed by HEK293 , with C-His labeled tag.

The ANGPTL7/Angiopoietin-related 7 protein assumes a crucial role in the formation and organization of the extracellular matrix. Particularly in the eye, it acts as a mediator of dexamethasone-induced matrix deposition within the trabecular meshwork, a tissue essential for the outflow of ocular aqueous humor and the maintenance of intraocular pressure. Additionally, ANGPTL7 serves as a negative regulator of angiogenesis in the cornea, playing a significant role in preserving corneal avascularity and transparency, as suggested by research findings. Structurally, it forms a homotetramer through disulfide linkages, further emphasizing its role in maintaining the structural integrity of the extracellular matrix in ocular tissues.

When Recombinant Human LILRB2 Protein is immobilized at 5 µg/mL (100 µL/well) can bind Biotinylated Rhesus Macaque ANGPTL7 Protein. The ED₅₀ for this effect is 0.472 μg/mL.

• 
  When Recombinant Human LILRB2 Protein is immobilized at 5 µg/mL (100µL/well) can bind Biotinylated Rhesus Macaque ANGPTL7 Protein. The ED₅₀ for this effect is 0.472 μg/mL.

Rhesus Macaque

HEK293

C-6*His

F7HQR6 (Q27-P344)

714204  [NCBI]

QKPSKRKTPAQLKAATCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYQDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP

Approximately 31-35 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 6.5, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.