1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. Angiopoietin Like 2
  5. ANGPTL2/Angiopoietin-like 2 Protein, Human (HEK293, His)

ANGPTL2/Angiopoietin-like 2 Protein, Human (HEK293, His)

Cat. No.: HY-P75577
COA Handling Instructions

ANGPTL2/angiopoietin-like 2 protein takes center stage as it induces endothelial cell sprouting through dual autocrine and paracrine mechanisms. This ability underscores its critical role in angiogenesis, where balanced signaling events control the formation of new blood vessels. ANGPTL2/Angiopoietin-like 2 Protein, Human (HEK293, His) is the recombinant human-derived ANGPTL2/Angiopoietin-like 2 protein, expressed by HEK293 , with N-His labeled tag. The total length of ANGPTL2/Angiopoietin-like 2 Protein, Human (HEK293, His) is 249 a.a., with molecular weight of ~34 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $85 In-stock
50 μg $220 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ANGPTL2/angiopoietin-like 2 protein takes center stage as it induces endothelial cell sprouting through dual autocrine and paracrine mechanisms. This ability underscores its critical role in angiogenesis, where balanced signaling events control the formation of new blood vessels. ANGPTL2/Angiopoietin-like 2 Protein, Human (HEK293, His) is the recombinant human-derived ANGPTL2/Angiopoietin-like 2 protein, expressed by HEK293 , with N-His labeled tag. The total length of ANGPTL2/Angiopoietin-like 2 Protein, Human (HEK293, His) is 249 a.a., with molecular weight of ~34 kDa.

Background

ANGPTL2/Angiopoietin-like 2 protein takes center stage as it exerts its influence on endothelial cells by inducing sprouting through a dual mechanism of autocrine and paracrine action. The protein's capacity to instigate sprouting underscores its pivotal role in angiogenic processes, where the intricate balance of signaling events governs the formation of new blood vessels. By operating both as an autocrine and paracrine factor, ANGPTL2 plays a crucial role in modulating endothelial cell behavior, contributing to the dynamic and coordinated responses essential for angiogenesis. This multifaceted action positions ANGPTL2 as a key player in the complex regulatory network that orchestrates vascular sprouting, highlighting its significance in the intricate processes of tissue vascularization.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human ANGPTL2 at 1 μg/mL (100 μL/well) can bind Recombinant Human ILT4. The ED50 for this effect is 20.45 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human ANGPTL2 at 1 μg/mL (100 μL/well) can bind Recombinant Human ILT4. The ED50 for this effect is 20.45 ng/mL.
Species

Human

Source

HEK293

Tag

N-6*His

Accession

Q9UKU9-1 (D245-H493)

Gene ID
Molecular Construction
N-term
His
ANGPTL2 (D245-H493)
Accession # Q9UKU9
C-term
Synonyms
Angiopoietin-related protein 2; ANGPTL2; ANGRP2; ARP2HARP; MGC8889
AA Sequence

DQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH

Molecular Weight

Approximately 34 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ANGPTL2/Angiopoietin-like 2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANGPTL2/Angiopoietin-like 2 Protein, Human (HEK293, His)
Cat. No.:
HY-P75577
Quantity:
MCE Japan Authorized Agent: