1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. Bone Morphogenetic Protein 3 (BMP-3/Osteogenin)
  6. Animal-Free BMP-3 Protein, Human (His)

BMP-3 Protein, a TGF-beta superfamily member, crucially influences early skeletal formation and acts as a bone density negative regulator. It counteracts osteogenic BMPs, hindering osteoprogenitor differentiation. BMP-3 initiates signaling via ACVR2B, activating SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK. Structurally, it forms homodimers with disulfide bonds, interacting with ACVR2B to regulate functions. Animal-Free BMP-3 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-3 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-3 Protein, Human (His) is 110 a.a., with molecular weight of ~13.34 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BMP-3 Protein, a TGF-beta superfamily member, crucially influences early skeletal formation and acts as a bone density negative regulator. It counteracts osteogenic BMPs, hindering osteoprogenitor differentiation. BMP-3 initiates signaling via ACVR2B, activating SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK. Structurally, it forms homodimers with disulfide bonds, interacting with ACVR2B to regulate functions. Animal-Free BMP-3 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-3 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-3 Protein, Human (His) is 110 a.a., with molecular weight of ~13.34 kDa.

Background

BMP-3 Protein, a member of the TGF-beta superfamily, plays a crucial role in developmental processes, particularly in inducing and patterning early skeletal formation, while concurrently acting as a negative regulator of bone density. Notably, it counteracts the osteogenic BMPs' ability to induce osteoprogenitor differentiation and ossification. The initiation of signaling cascades involves BMP-3 associating with the type II receptor ACVR2B, activating both SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK pathways. Structurally, BMP-3 exists as a homodimer linked by disulfide bonds and interacts with the type II receptor ACVR2B to exert its regulatory functions.

Biological Activity

1.Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <9.5 ng/mL.
2.Measure by its ability to inhibit BMP-2-induced alkaline phosphataseproduction by ATDC5 cells. The ED50 for this effect is <10 μg/mL .

Species

Human

Source

E. coli

Tag

C-His

Accession

P12645 (Q363-R472)

Gene ID

651  [NCBI]

Molecular Construction
N-term
BMP-3 (Q363-R472)
Accession # P12645
His
C-term
Synonyms
Osteogenin; BMP-3A
AA Sequence

MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Molecular Weight

Approximately 13.34 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free BMP-3 Protein, Human (His)
Cat. No.:
HY-P700026AF
Quantity:
MCE Japan Authorized Agent: