Animal-Free BMP-3 Protein, Human (His)

BMP-3 Protein, a TGF-beta superfamily member, crucially influences early skeletal formation and acts as a bone density negative regulator. It counteracts osteogenic BMPs, hindering osteoprogenitor differentiation. BMP-3 initiates signaling via ACVR2B, activating SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK. Structurally, it forms homodimers with disulfide bonds, interacting with ACVR2B to regulate functions. Animal-Free BMP-3 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-3 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-3 Protein, Human (His) is 110 a.a., with molecular weight of ~13.34 kDa.

BMP-3 Protein, a member of the TGF-beta superfamily, plays a crucial role in developmental processes, particularly in inducing and patterning early skeletal formation, while concurrently acting as a negative regulator of bone density. Notably, it counteracts the osteogenic BMPs' ability to induce osteoprogenitor differentiation and ossification. The initiation of signaling cascades involves BMP-3 associating with the type II receptor ACVR2B, activating both SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK pathways. Structurally, BMP-3 exists as a homodimer linked by disulfide bonds and interacts with the type II receptor ACVR2B to exert its regulatory functions.

1.Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <9.5 ng/mL.
2.Measure by its ability to inhibit BMP-2-induced alkaline phosphataseproduction by ATDC5 cells. The ED₅₀ for this effect is <10 μg/mL .

Human

E. coli

C-His

P12645 (Q363-R472)

651  [NCBI]

MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Approximately 13.34 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.