Animal-Free BMP-8b Protein, Human (His)

BMP-8 is a pleiotropic ligand protein act as a reproductive system regulator, enriched in the ovary. BMP-8 is encoded by a pair of genes BMP8A and BMP8B, belonging to TNF-β family^[1]. BMP-8B is secreted by brown/beige adipocytes and enhances energy dissipation, serves as a potential targets in obesity^[2]. BMP-8B also caspase-3 and -9 activation in pancreatic cancer cell, as well as decreasing mitochondrial membrane potential to induce apoptosis^[3]. BMP-8b Protein, Human is 402 a.a. with 2 glycosylation domains. Animal-Free BMP-8a Protein, Human (His) is a animal free recombinant human protein produced in E. coli cells, with 139 a.a. (A264-H402) and N-terminal His-tag.

"BMP-8 is a pleiotropic ligand protein act as a reproductive system regulator. BMP-8 is encoded by a pair of genes, BMP8A and BMP8B, belonging to TNF-β family. GMP-8 initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2. Both BMP8A and BMP8B are enriched in the ovary and activate canonical BMP signaling in different cells, including spermatogonia, P19 and 293T cells^[1]. BMP-8 is widely found in different animals, while the sequences of BMP-8A and BMP-8B in human are highly different from Mouse with similarities of 85.96% and 74.44%, respectively.
As for BMP8A, which is mainly secreted by granulosa cells within growing ovarian follicles. BMP8A encodes a secreted ligand of the TGF-β superfamily of proteins to bind various TGF-beta receptors, leading to recruitment and activation of SMAD family transcription factors and regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer^[4]. BMP-8A protein activates the SMAD1/5/8 and the SMAD2/3 pathways in granulosa cells, to inhibit gonadotropin-induced progesterone production and steroidogenesis-related gene expression^[1]. BMP8A protein plays a role in development of the reproductive system by sustaining spermatogenesis by activating both SMAD1/5/9 and SMAD2/3 in spermatogonia. BMP-8A protein also activates Nrf2 and Wnt pathways in clear cell renal cell carcinoma (ccRCC) to promote cell proliferation and inhibit apoptosis^[4].
As for BMP8B, which protein is secreted by brown/beige adipocytes and enhances energy dissipation, serves as an interconnected regulator of neuro-vascular remodeling in adipose tissue (AT) and is potential targets in obesity^[2]. BMP8B increases brown adipose tissue thermogenesis through both central and peripheral actions^[5]. Thus BMP8B contributes to adrenergic-induced remodeling of the neuro-vascular network in adipose tissue, therefore through the adipocytes to 1) secrete neuregulin-4 (NRG4), which promotes sympathetic axon growth and branching in vitro, and 2) induce a pro-angiogenic transcriptional and secretory profile that promotes vascular sprouting^[3]. BMP8B also involve in activation of caspase-3 and -9, and apoptosis to inhibit pancreatic cancer cell growth^[3].
"

BMP-8b (5 ng/mL; 36 hr) promotes Blimp1-mVenus (BV) induction in the epiblasts from the E6. embryonic fragments bearing VE and Epi (ExE removed) in the serum-free basal medium, accompanied with 5 ng/mL BMP-4^[6].

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <21.8 ng/mL.

Human

E. coli

N-His

P34820 (A264-H402)

656  [NCBI]

AVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH

Approximately 16.48 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

<0.01 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Wu FJ, et al. Human BMP8A suppresses luteinization of rat granulosa cells via the SMAD1/5/8 pathway. Reproduction. 2020 Mar;159(3):315-324.  [Content Brief]

  [2]. Pellegrinelli V, et al. Adipocyte-secreted BMP8b mediates adrenergic-induced remodeling of the neuro-vascular network in adipose tissue. Nat Commun. 2018 Nov 26;9(1):4974.  [Content Brief]

  [3]. Cheng Z, et al. BMP8B mediates the survival of pancreatic cancer cells and regulates the progression of pancreatic cancer. Oncol Rep. 2014 Nov;32(5):1861-6.  [Content Brief]

  [4]. Yu YP, et al. BMP8A promotes survival and drug resistance via Nrf2/TRIM24 signaling pathway in clear cell renal cell carcinoma. Cancer Sci. 2020 May;111(5):1555-1566.  [Content Brief]

  [5]. Whittle AJ, et al. BMP8B increases brown adipose tissue thermogenesis through both central and peripheral actions. Cell. 2012 May 11;149(4):871-85.  [Content Brief]

  [6]. Ohinata Y, et al. A signaling principle for the specification of the germ cell lineage in mice. Cell. 2009 May 1;137(3):571-84.  [Content Brief]