1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. BCA-1/CXCL13
  6. Animal-Free CXCL13 Protein, Pig (His)

The CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. Animal-Free CXCL13 Protein, Pig (His) is the recombinant pig-derived animal-FreeCXCL13 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free CXCL13 Protein, Pig (His) is 88 a.a., with molecular weight of ~10.81 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. Animal-Free CXCL13 Protein, Pig (His) is the recombinant pig-derived animal-FreeCXCL13 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free CXCL13 Protein, Pig (His) is 88 a.a., with molecular weight of ~10.81 kDa.This product is for cell culture use only.

Background

The CXCL13 protein is a member of the intercrine alpha (chemokine CxC) family, signifying its participation in a group of chemokines essential for intercellular communication and immune responses. Within the intercrine alpha family, CXCL13 likely plays a pivotal role in modulating inflammatory processes and influencing cellular interactions. Further exploration is crucial to unveil the specific functions and implications of this protein within the broader context of the chemokine CxC family.

Species

Pig

Source

E. coli

Tag

N-His

Accession

A0A4X1SVT8 (V24-A111)

Gene ID
Molecular Construction
N-term
His
CXCL13 (V24-A111)
Accession # A0A4X1SVT8
C-term
Synonyms
C-X-C motif chemokine 13; BCA1; BLC; SCYB13
AA Sequence

VLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA

Molecular Weight

Approximately 10.81 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free CXCL13 Protein, Pig (His)
Cat. No.:
HY-P700234AF
Quantity:
MCE Japan Authorized Agent: