Animal-Free CXCL16 Protein, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free CXCL16 Protein, Mouse (His) is 175 a.a., with molecular weight of ~10.74 kDa.

The CXCL16 protein exhibits multifaceted functionalities, including the induction of a robust chemotactic response and the initiation of calcium mobilization. Functioning as a ligand, it binds to CXCR6/Bonzo, thereby contributing to cellular signaling processes. Beyond its role as a chemotactic factor, CXCL16 serves as a scavenger receptor on macrophages, displaying a specific affinity for oxidized low-density lipoprotein (OxLDL). This interaction suggests its potential involvement in pathophysiological processes, particularly atherogenesis, where the recognition and clearance of OxLDL by macrophages play a crucial role. The diverse activities of CXCL16 highlight its versatility and underscore its potential implications in cellular responses and pathological conditions.

Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR6. The ED₅₀ for this effect is <3 ng/mL.

Mouse

E. coli

N-His

Q8BSU2 (N27-W201)

66102  [NCBI]

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Approximately 10.74 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.