1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-11
  6. Animal-Free FGF-11 isoform 1 Protein, Human (His)

Animal-Free FGF-11 isoform 1 Protein, Human (His)

Cat. No.: HY-P700054AF
Handling Instructions Technical Support

The FGF-11 isoform 1 protein is thought to play an important role in the development and function of the nervous system. Its presence indicates involvement in complex processes responsible for establishing and maintaining neural structure and activity. Animal-Free FGF-11 isoform 1 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-11 isoform 1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-11 isoform 1 Protein, Human (His) is 225 a.a., with molecular weight of ~25.81 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGF-11 isoform 1 protein is thought to play an important role in the development and function of the nervous system. Its presence indicates involvement in complex processes responsible for establishing and maintaining neural structure and activity. Animal-Free FGF-11 isoform 1 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-11 isoform 1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-11 isoform 1 Protein, Human (His) is 225 a.a., with molecular weight of ~25.81 kDa.This product is for cell culture use only.

Background

FGF-11 isoform 1 Protein is believed to play a significant role in the development and functioning of the nervous system. Its presence suggests involvement in the intricate processes responsible for establishing and maintaining neural structures and activities. As a member of the fibroblast growth factor (FGF) family, this isoform likely contributes to neural growth, differentiation, and communication. Although further research is required to fully comprehend the precise mechanisms and functions of FGF-11 isoform 1 Protein, its potential importance in neural development highlights its significance as a key player in the intricate orchestration of the nervous system.

Biological Activity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <0.2 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q92914 (M1-P225)

Gene ID
Molecular Construction
N-term
FGF-11 isoform 1 (M1-P225)
Accession # Q92914
His
C-term
Synonyms
Fibroblast growth factor 11; FHF-3; FHF3; Fibroblast growth factor homologous factor 3
AA Sequence

MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP

Molecular Weight

Approximately 25.81 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.01 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free FGF-11 isoform 1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free FGF-11 isoform 1 Protein, Human (His)
Cat. No.:
HY-P700054AF
Quantity:
MCE Japan Authorized Agent: