Animal-Free FGF-11 isoform 2 Protein, Human (His)

FGF-11 isoform 2 protein is a member of the fibroblast growth factor family, characterized by broad mitotic and cell survival activities, affecting embryonic development, cell growth, morphogenesis, tissue repair, and tumor growth. Its specific function has not yet been determined, but the expression pattern of its mouse homolog suggests a role in nervous system development. Animal-Free FGF-11 isoform 2 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-11 isoform 2 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-11 isoform 2 Protein, Human (His) is 166 a.a., with molecular weight of ~19.34 kDa.

The protein encoded by this gene belongs to the fibroblast growth factor (FGF) family, known for its broad mitogenic and cell survival activities involved in various biological processes such as embryonic development, cell growth, morphogenesis, tissue repair, and tumor growth. While the specific function of this gene remains to be determined, the expression pattern of its mouse homolog suggests a role in nervous system development. Alternative splicing results in the generation of multiple transcript variants. This FGF-11 isoform 2 protein exhibits broad expression, with notable levels detected in the adrenal gland (RPKM 9.9), skin (RPKM 7.0), and 14 other tissues.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <1 ng/mL.

Human

E. coli

C-His

NP_001290389.1 (M1-P166)

2256  [NCBI]

MSLSPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP

Approximately 19.34 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.