Animal-Free FGF-12 Protein, Human (His)

FGF-12, vital for nervous system development, positively regulates voltage-gated sodium channels, particularly SCN8A, enhancing neuronal excitability. It achieves this by elevating the voltage dependence of SCN8A fast inactivation. FGF-12 interacts specifically with the C-terminal region of SCN9A. Animal-Free FGF-12 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-12 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-12 Protein, Human (His) is 181 a.a., with molecular weight of ~21.23 kDa.

FGF-12, a pivotal player in nervous system development and function, exerts its influence by positively regulating the activity of voltage-gated sodium channels. Specifically, FGF-12 contributes to the enhancement of neuronal excitability by modulating the voltage dependence of SCN8A fast inactivation, thereby influencing the dynamics of sodium channel behavior. This intricate regulatory role underscores FGF-12's significance in shaping neuronal activity and highlights its interaction with the C-terminal region of SCN9A, emphasizing its involvement in the intricate molecular interplay associated with voltage-gated sodium channel function.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is < 2 ng/mL.

Human

E. coli

C-His

P61328-2 (M1-T181)

2257  [NCBI]

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Approximately 21.23 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.