1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. CXCL6
  6. Animal-Free GCP-2/CXCL6 Protein, Human (His)

Animal-Free GCP-2/CXCL6 Protein, Human (His)

Cat. No.: HY-P700048AF
SDS COA Handling Instructions Technical Support

The GCP-2/CXCL6 protein is a chemokine that eliminates pathogens by attracting neutrophils, basophils, and T cells and is an important mediator in inflammation. It activates neutrophils by binding to the G protein-coupled receptors CXCR1 and CXCR2, which are mainly expressed on neutrophils, monocytes, and endothelial cells. Animal-Free GCP-2/CXCL6 Protein, Human (His) is the recombinant human-derived animal-FreeGCP-2/CXCL6 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free GCP-2/CXCL6 Protein, Human (His) is 75 a.a., with molecular weight of ~8.97 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GCP-2/CXCL6 protein is a chemokine that eliminates pathogens by attracting neutrophils, basophils, and T cells and is an important mediator in inflammation. It activates neutrophils by binding to the G protein-coupled receptors CXCR1 and CXCR2, which are mainly expressed on neutrophils, monocytes, and endothelial cells. Animal-Free GCP-2/CXCL6 Protein, Human (His) is the recombinant human-derived animal-FreeGCP-2/CXCL6 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free GCP-2/CXCL6 Protein, Human (His) is 75 a.a., with molecular weight of ~8.97 kDa.

Background

CXCL8, a chemotactic factor, serves as a pivotal mediator in the inflammatory response by attracting neutrophils, basophils, and T-cells to eliminate pathogens and safeguard the host from infections. This protein also plays a crucial role in activating neutrophils. Upon release in response to an inflammatory stimulus, CXCL8 exerts its effects by binding to the G-protein-coupled receptors CXCR1 and CXCR2, predominantly expressed in neutrophils, monocytes, and endothelial cells. The binding triggers the release of G-protein heterotrimer (alpha, beta, gamma subunits) from the CXCR1/CXCR2 receptor, leading to the activation of downstream signaling pathways, including PI3K and MAPK pathways. CXCL8's homodimeric structure facilitates its interactions, and it has been shown to interact with TNFAIP6, disrupting chemokine binding to glycosaminoglycans. This multifaceted role underscores the importance of CXCL8 in orchestrating immune responses during inflammation.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <10 ng/mL.

Species

Human

Source

E. coli

Tag

N-His

Accession

P80162 (V40-N114)

Gene ID
Molecular Construction
N-term
His
CXCL6 (V40-N114)
Accession # P80162
C-term
Synonyms
C-X-C motif chemokine 6; CKA-3; GCP-2; CXCL6; GCP2; SCYB6
AA Sequence

VSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

Molecular Weight

Approximately 8.97 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free GCP-2/CXCL6 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free GCP-2/CXCL6 Protein, Human (His)
Cat. No.:
HY-P700048AF
Quantity:
MCE Japan Authorized Agent: