Animal-Free GRO-alpha/CXCL1 Protein, Mouse (His)

GRO-alpha (CXCL1) Protein, with chemotactic properties, attracts and activates neutrophils during inflammatory responses. This hematoregulatory chemokine also suppresses hematopoietic progenitor cell proliferation, emphasizing its intricate role in hematopoiesis regulation. The truncated form KC(5-72) notably exhibits significantly enhanced hematopoietic activity in vitro. Animal-Free GRO-alpha/CXCL1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeGRO-alpha/CXCL1 protein, expressed by E. coli , with tag free. The total length of Animal-Free GRO-alpha/CXCL1 Protein, Mouse (His) is 68 a.a., with molecular weight of ~7.45 kDa.

GRO-alpha (CXCL1) Protein exhibits chemotactic properties, attracting neutrophils and contributing to their activation during inflammatory responses. Additionally, this hematoregulatory chemokine displays the ability to suppress the proliferation of hematopoietic progenitor cells, highlighting its intricate role in regulating hematopoiesis. Notably, the truncated form KC(5-72) exhibits significantly enhanced hematopoietic activity in vitro.

The ED₅₀ is <15 ng/mL as measure by its ability to chemoattract BaF3 cells transfected with human CXCR2.

Mouse

E. coli

Tag Free

P12850 (N29-K96)

14825  [NCBI]

NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Approximately 7.45 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.