Animal-Free GRO-gamma/CXCL3 Protein, Human (His)

The GRO-gama/CXCL3 Protein, acting as a CXCR2 ligand, induces chemotactic activity for neutrophils. It potentially influences inflammation through autocrine effects on endothelial cells. In vitro studies highlight the processed form GRO-gamma(5-73)'s fivefold increase in chemotactic activity for neutrophilic granulocytes, indicating a potential regulatory mechanism for neutrophil recruitment and function. Animal-Free GRO-gama/CXCL3 Protein, Human (His) is the recombinant human-derived animal-FreeGRO-gama/CXCL3 protein, expressed by E. coli , with N-His, N-His labeled tag. The total length of Animal-Free GRO-gamma/CXCL3 Protein, Human (His) is 73 a.a., with molecular weight of ~8.67 kDa.

The GRO-gama/CXCL3 protein acts as a ligand for CXCR2, demonstrating chemotactic activity for neutrophils. This protein may play a role in inflammation, exerting its effects on endothelial cells in an autocrine fashion. Notably, in vitro studies reveal that the processed form GRO-gamma(5-73) exhibits a fivefold higher chemotactic activity for neutrophilic granulocytes, suggesting a potential regulatory mechanism for neutrophil recruitment and function.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <2 ng/mL.

Human

E. coli

N-His;N-His

P19876 (A35-N107)

2921  [NCBI]

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Approximately 8.67 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.