Animal-Free IFN-lambda 2/IL-28A Protein, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is 174 a.a., with molecular weight of ~20.60 kDa.

IFN-lambda 2/IL-28A Protein, a versatile cytokine, possesses antiviral, antitumor, and immunomodulatory activities. It assumes a pivotal role in antiviral host defense, particularly within epithelial tissues. Functioning as a ligand for the heterodimeric class II cytokine receptor comprising IL10RB and IFNLR1, its engagement activates the JAK/STAT signaling pathway, leading to the expression of IFN-stimulated genes (ISG) that establish the antiviral state. Notably, its receptor distribution is confined, primarily exerting its effects in epithelial cells due to the cell type-selective expression of the receptor IFNLR1. While not deemed essential for early virus-activated host defense in vaginal infection, it proves vital in Toll-like receptor (TLR)-induced antiviral defense. It plays a significant role in antiviral immune defense within the intestinal epithelium. Furthermore, IFN-lambda 2/IL-28A contributes to immunomodulation by up-regulating MHC class I antigen expression, enhancing its impact on immune responses.

Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <20 ng/mL.

Human

E. coli

C-His

Q8IZJ0 (P27-V200)

282616  [NCBI]

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Approximately 20.60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.