Animal-Free IL-17A Protein, Human (His)

The IL-17A protein is an important effector cytokine that is critical in both innate and adaptive immunity to defend against microorganisms and maintain tissue integrity. It acts through the IL17RA-IL17RC heterodimeric receptor complex, triggering signaling pathways, activating immune-related gene transcription and promoting strong immune inflammation. Animal-Free IL-17A Protein, Human (His) is the recombinant human-derived animal-FreeIL-17A protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-17A Protein, Human (His) is 136 a.a., with molecular weight of ~16.47 kDa.

The IL-17A Protein is a vital effector cytokine in both innate and adaptive immune responses, playing a crucial role in antimicrobial defense and tissue integrity maintenance. Operating through the IL17RA-IL17RC heterodimeric receptor complex, it triggers downstream signaling pathways, resulting in the transcriptional activation of immune-related genes and potential strong immune inflammation. As a signature effector cytokine of Th17 cells, it induces neutrophil activation and recruitment at infection sites, contributing to host defense against extracellular bacteria and fungi. Additionally, the heterodimer participates in germinal center formation, mediates chemotaxis, and plays a significant role in epithelial barrier maintenance during homeostasis and infection. It forms homodimers and heterodimers, showcasing its versatility in orchestrating diverse immune processes. The IL-17A Protein emerges as a key player in connecting T cell-mediated adaptive immunity with acute inflammatory responses, highlighting its multifaceted role in immune regulation and cellular homeostasis.

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <6 ng/mL.

Human

E. coli

C-His

Q16552 (I20-A155)

3605  [NCBI]

MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Approximately 16.47 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.01 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.