Animal-Free IL-2 Protein, Pig (His)

IL-2 is produced by antigen-activated CD4+ T cells, CD8+ T cells, NK cells and NKT cells. IL-2 is involved in signaling pathways including JAK/STAT, inosine phosphate 3-kinase /PI3K and mitogen-activated protein kinase /MAPK. IL-2 can be used in the research of cancer immunotherapy. Animal-Free IL-2 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-2 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-2 Protein, Pig (His) is 134 a.a., with molecular weight of ~16.2 kDa.

IL-2 is a receptor cytokine produced by activated CD4-positive helper T cells and plays its role by activating JAK/STAT, inosine phosphate 3-kinase /PI3K and mitogen-activated protein kinase /MAPK. IL-2 binds to receptor complexes consisting of high affinity trimers IL-2R (IL2RA/CD25, IL2RB/CD122 and IL2RG/CD132) or low affinity dimers IL-2R (IL2RB and IL2RG). IL-2 can increase the cytolytic activity of NK cells. Promote strong proliferation of activated B cells and immunoglobulin production. IL-2 is involved in the differentiation and homeostasis of effector T cell subsets, including Th1, Th2, Th17, and memory CD8-positive T cells. IL-2 synthesis is strictly regulated by TCR and CD28 signaling at the mRNA level. It mediates the activation-induced cell death (AICD) process. IL-2 can be used in the research of cancer immunotherapy^[1][2][3][4].

Measure by its ability to induce proliferation in CTLL2 cells. The ED₅₀ for this effect is < 0.5 ng/mL.

Pig

E. coli

C-His

P26891(A21-T154)

396868  [NCBI]

MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT

Approximately 16.2 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.