1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-20
  5. Animal-Free IL-20 Protein, Human (His)

IL-20 protein is a proinflammatory cytokine secreted by monocytes and keratinocytes that is critical for immune responses, inflammation, hematopoiesis, and epidermal cell differentiation. It plays a key role in tissue remodeling, wound healing, and maintenance of epithelial homeostasis during infection. Animal-Free IL-20 Protein, Human (His) is the recombinant human-derived animal-FreeIL-20 protein, expressed by E. coli , with C-His labeled tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-20 protein is a proinflammatory cytokine secreted by monocytes and keratinocytes that is critical for immune responses, inflammation, hematopoiesis, and epidermal cell differentiation. It plays a key role in tissue remodeling, wound healing, and maintenance of epithelial homeostasis during infection. Animal-Free IL-20 Protein, Human (His) is the recombinant human-derived animal-FreeIL-20 protein, expressed by E. coli , with C-His labeled tag.

Background

IL-20 Protein, a pro-inflammatory and angiogenic cytokine predominantly secreted by monocytes and skin keratinocytes, assumes critical roles in immune responses, inflammatory regulation, hemopoiesis, and the differentiation of epidermal cells and keratinocytes. It plays a pivotal part in tissue remodeling and wound-healing processes, contributing to the restoration of epithelial layer homeostasis during infections and inflammatory responses, thereby maintaining tissue integrity. Notably, IL-20 impacts various actin-mediated functions in activated neutrophils, leading to the inhibition of phagocytosis, granule exocytosis, and migration. Its effects are mediated through the type I IL-20 receptor complex, comprising IL20RA and IL20RB, or, alternatively, through the type II IL-20 receptor complex, consisting of IL22RA1 and IL20RB. Functioning as an arteriogenic and vascular remodeling agent, IL-20 activates diverse signaling processes, including the phosphorylation of JAK2 and STAT5, as well as the activation of serine and threonine kinases AKT and ERK1/2. Additionally, it forms a 1:1:1 heterotrimeric complex with its primary high-affinity heterodimeric receptor IL20RA/IL20RB.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human IL-20R alpha and IL-20R beta. The ED50 for this effect is <0.2 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q9NYY1-1 (L25-E176)

Gene ID
Molecular Construction
N-term
IL-20 (L25-E176)
Accession # Q9NYY1-1
His
C-term
Synonyms
rHuIL-20; IL20; Cytokine Zcyto10
AA Sequence

MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE

Molecular Weight

Approximately 18.47 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-20 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-20 Protein, Human (His)
Cat. No.:
HY-P700111AF
Quantity:
MCE Japan Authorized Agent: