Animal-Free IL-21 Protein, Mouse (His)

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG(1) and IgG(3) by B cells, thereby forming a humoral immune response. Animal-Free IL-21 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-21 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-21 Protein, Mouse (His) is 129 a.a., with molecular weight of ~15.9 kDa.

IL-21, a cytokine endowed with immunoregulatory prowess, emerges as a key player in orchestrating the delicate transition between innate and adaptive immunity. This multifaceted regulator takes the stage in inducing the production of IgG(1) and IgG(3) in B-cells, thereby substantiating its pivotal role in shaping humoral immune responses. IL-21 finds its niche in fostering the generation and perpetuation of T follicular helper (Tfh) cells and the intricate formation of germinal centers. Collaborating synergistically with IL6, it exercises command over the early development of Tfh cells, contributing indispensably to a robust antibody response during acute viral infections. Beyond B-cells, IL-21 extends its influence to the realm of natural killer (NK) cells, where, in synergy with IL15, it fuels their proliferation and maturation. Further, IL-21 flexes its regulatory muscle, guiding the proliferation and maturation of mature B- and T-cells in response to activating stimuli. In tandem with IL15 and IL18, it orchestrates the production of interferon-gamma in both T-cells and NK cells. Notably, during T-cell-mediated immune responses, IL-21 steps in as a potential inhibitor, dampening the activation and maturation of dendritic cells, unveiling a nuanced regulatory role in immune dynamics.

Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED₅₀ for this effect is <6 ng/mL. The specific activity of recombinant mouse IL-21 is >1.6 x 10⁵IU/mg

Mouse

E. coli

C-His

Q9ES17 (H18-S146)

60505  [NCBI]

MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Approximately 15.9 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.