Animal-Free IL-32 alpha Protein, Human (His)

IL-32 alpha Protein, a cytokine, potentially contributes to innate and adaptive immune responses. It induces TNFA/TNF-alpha and IL8, activating typical cytokine signal pathways, including NF-kappa-B and p38 MAPK. Animal-Free IL-32 alpha Protein, Human (His) is the recombinant human-derived animal-FreeIL-32 alpha protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-32 alpha Protein, Human (His) is 131 a.a., with molecular weight of ~15.72 kDa.

IL-32 alpha protein, classified as a cytokine, is implicated in both innate and adaptive immune responses. This protein demonstrates the ability to induce the expression of various cytokines, including TNFA/TNF-alpha and IL8, thereby influencing the inflammatory milieu. Furthermore, the signaling pathways triggered by IL-32 alpha encompass the canonical pathways of NF-kappa-B and p38 MAPK, highlighting its involvement in orchestrating diverse cellular responses associated with immune regulation. This underscores the potential significance of IL-32 alpha in the intricate network of immune signaling cascades, contributing to the modulation of inflammatory and immune processes.

Measure by its ability to induce TNF alpha secretion in RAW264.7 cells. The ED₅₀ for this effect is <10 μg/mL.

Human

E. coli

C-His

P24001-4 (M1-K131)

9235  [NCBI]

MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK

Approximately 15.72 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.