1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-33
  5. Animal-Free IL-33 Protein, Mouse (His)

IL-33 protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells and enhances macrophage polarization. Animal-Free IL-33 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-33 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-33 Protein, Mouse (His) is 158 a.a., with molecular weight of ~18.51 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-33 protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells and enhances macrophage polarization. Animal-Free IL-33 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-33 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-33 Protein, Mouse (His) is 158 a.a., with molecular weight of ~18.51 kDa.

Background

The IL-33 Protein, a cytokine, binds to and signals through the IL1RL1/ST2 receptor, activating NF-kappa-B and MAPK signaling pathways in target cells. It is implicated in the maturation of Th2 cells, inducing the secretion of T-helper type 2-associated cytokines. Furthermore, IL-33 is involved in the activation of mast cells, basophils, eosinophils, and natural killer cells, acting as an enhancer of the polarization of alternatively activated macrophages. It serves as a chemoattractant for Th2 cells and may function as an 'alarmin,' amplifying immune responses during tissue injury. Notably, it induces rapid UCP2-dependent mitochondrial rewiring, attenuating the generation of reactive oxygen species and preserving the integrity of the Krebs cycle required for the persistent production of itaconate, leading to GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages. In quiescent endothelia, the uncleaved form of IL-33 is constitutively and abundantly expressed, acting as a chromatin-associated nuclear factor with transcriptional repressor properties, potentially sequestering nuclear NF-kappaB/RELA and lowering the expression of its targets. This form is rapidly lost upon angiogenic or pro-inflammatory activation.

Biological Activity

Measure by its ability to induce proliferation in D10.G4.1 cells. The ED50 for this effect is <40 pg/mL. The specific activity of recombinant mouse IL-33 is >2 x 106 IU/mg.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

Q8BVZ5 (S109-I266)

Gene ID
Molecular Construction
N-term
IL-33 (S109-I266)
Accession # Q8BVZ5
His
C-term
Synonyms
Interleukin-33; IL-33; Interleukin-1 FamILy Member 11; IL-1F11; Nuclear Factor From High Endothelial Venules; NF-HEV; IL33; C9orf26; IL1F11; NFHEV
AA Sequence

MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Molecular Weight

Approximately 18.51 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose or PBS, pH 7.4.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-33 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-33 Protein, Mouse (His)
Cat. No.:
HY-P700208AF
Quantity:
MCE Japan Authorized Agent: