1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-33
  5. Animal-Free IL-33 Protein, Mouse (His)

Animal-Free IL-33 Protein, Mouse (His)

Cat. No.: HY-P700208AF
COA Handling Instructions

IL-33 protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells and enhances macrophage polarization. Animal-Free IL-33 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-33 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-33 Protein, Mouse (His) is 158 a.a., with molecular weight of ~18.51 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $40 In-stock
10 μg $100 In-stock
50 μg $280 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-33 protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells and enhances macrophage polarization. Animal-Free IL-33 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-33 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-33 Protein, Mouse (His) is 158 a.a., with molecular weight of ~18.51 kDa.

Background

The IL-33 Protein, a cytokine, binds to and signals through the IL1RL1/ST2 receptor, activating NF-kappa-B and MAPK signaling pathways in target cells. It is implicated in the maturation of Th2 cells, inducing the secretion of T-helper type 2-associated cytokines. Furthermore, IL-33 is involved in the activation of mast cells, basophils, eosinophils, and natural killer cells, acting as an enhancer of the polarization of alternatively activated macrophages. It serves as a chemoattractant for Th2 cells and may function as an 'alarmin,' amplifying immune responses during tissue injury. Notably, it induces rapid UCP2-dependent mitochondrial rewiring, attenuating the generation of reactive oxygen species and preserving the integrity of the Krebs cycle required for the persistent production of itaconate, leading to GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages. In quiescent endothelia, the uncleaved form of IL-33 is constitutively and abundantly expressed, acting as a chromatin-associated nuclear factor with transcriptional repressor properties, potentially sequestering nuclear NF-kappaB/RELA and lowering the expression of its targets. This form is rapidly lost upon angiogenic or pro-inflammatory activation.

Biological Activity

Measure by its ability to induce proliferation in D10.G4.1 cells. The ED50 for this effect is <40 pg/mL. The specific activity of recombinant mouse IL-33 is >2 x 106 IU/mg.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

Q8BVZ5 (S109-I266)

Gene ID

77125  [NCBI]

Molecular Construction
N-term
IL-33 (S109-I266)
Accession # Q8BVZ5
His
C-term
Synonyms
Interleukin-33; IL-33; Interleukin-1 FamILy Member 11; IL-1F11; Nuclear Factor From High Endothelial Venules; NF-HEV; IL33; C9orf26; IL1F11; NFHEV
AA Sequence

MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Molecular Weight

Approximately 18.51 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-33 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-33 Protein, Mouse (His)
Cat. No.:
HY-P700208AF
Quantity:
MCE Japan Authorized Agent: