Animal-Free IL-33 Protein, Mouse (His)

IL-33 protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells and enhances macrophage polarization. Animal-Free IL-33 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-33 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-33 Protein, Mouse (His) is 158 a.a., with molecular weight of ~18.51 kDa.

The IL-33 Protein, a cytokine, binds to and signals through the IL1RL1/ST2 receptor, activating NF-kappa-B and MAPK signaling pathways in target cells. It is implicated in the maturation of Th2 cells, inducing the secretion of T-helper type 2-associated cytokines. Furthermore, IL-33 is involved in the activation of mast cells, basophils, eosinophils, and natural killer cells, acting as an enhancer of the polarization of alternatively activated macrophages. It serves as a chemoattractant for Th2 cells and may function as an 'alarmin,' amplifying immune responses during tissue injury. Notably, it induces rapid UCP2-dependent mitochondrial rewiring, attenuating the generation of reactive oxygen species and preserving the integrity of the Krebs cycle required for the persistent production of itaconate, leading to GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages. In quiescent endothelia, the uncleaved form of IL-33 is constitutively and abundantly expressed, acting as a chromatin-associated nuclear factor with transcriptional repressor properties, potentially sequestering nuclear NF-kappaB/RELA and lowering the expression of its targets. This form is rapidly lost upon angiogenic or pro-inflammatory activation.

Measure by its ability to induce proliferation in D10.G4.1 cells. The ED₅₀ for this effect is <40 pg/mL. The specific activity of recombinant mouse IL-33 is >2 x 10⁶ IU/mg.

Mouse

E. coli

C-His

Q8BVZ5 (S109-I266)

77125  [NCBI]

MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Approximately 18.51 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.