Animal-Free IL-36RN Protein, Human (His)

IL-36RN protein tightly regulates immunity by inhibiting the activity of interleukin 36 (IL36A, IL36B, IL36G).It binds to the IL-36 receptor (IL1RL2), preventing binding to IL1RAP and blocking downstream signaling.Animal-Free IL-36RN Protein, Human (His) is the recombinant human-derived animal-FreeIL-36RN protein, expressed by E.coli , with C-His labeled tag.

IL-36RN protein assumes a critical role in immune regulation by inhibiting the activity of interleukin-36 (IL36A, IL36B, and IL36G). This inhibition is achieved through its binding to the IL-36 receptor (IL1RL2), preventing its association with the coreceptor IL1RAP, thus impeding downstream signaling. As part of the IL-36 signaling system, analogous to the IL-1 system, IL-36RN is believed to function in epithelial barriers, contributing to local inflammatory responses. This protein is implicated in skin inflammation and is proposed to participate in the innate immune response against fungal pathogens, exemplified by its potential role in countering Aspergillus fumigatus. Furthermore, IL-36RN may activate an anti-inflammatory signaling pathway by recruiting SIGIRR. Notably, its interaction with the cargo receptor TMED10 facilitates translocation from the cytoplasm into the ERGIC, enabling secretion and underscoring its multifaceted regulatory functions.

Measure by its ability to inhibit IL-36 gamma-induced IL-8 secretion in PBMC cells. The ED₅₀ for this effect is <2 ng/mL in the presence of 500 ng/mL of recombinant human IL-36 gamma.

Human

E. coli

C-His

Q9UBH0 (M1-T108)

26525  [NCBI]

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLT

Approximately 17.77 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.