1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-4
  5. Animal-Free IL-4 Protein, Mouse (His)

Interleukin 4 (IL-4) Protein is a pleiotropic cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses.IL-4 participates in STAT6 signaling and regulates the expression of MHC II, IgE, IgG1 amd CD23.Animal-Free IL-4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-4 protein, expressed by E.coli , with C-His labeled tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Interleukin 4 (IL-4) Protein is a pleiotropic cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses.IL-4 participates in STAT6 signaling and regulates the expression of MHC II, IgE, IgG1 amd CD23.Animal-Free IL-4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-4 protein, expressed by E.coli , with C-His labeled tag.

Background

Interleukin 4 (IL-4) Protein is a pleiotropic cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses. IL-4 gene encodes two distinct isoforms through alternatively spliced transcription.
IL-4 is a ligand for interleukin 4 receptor (IL4R). IL4R also binds to IL-13, which may contribute to many overlapping functions of IL-4 and IL-13. Upon binding to IL4, IL4R receptor dimerizes either with the common IL2R gamma chain (IL2RG) to produce the type 1 signaling complex, located mainly on hematopoietic cells, or with the IL13RA1 to produce the type 2 complex, which is expressed also on nonhematopoietic cells. Engagement of both types of receptors initiates JAK3 and to a lower extend JAK1 phosphorylation leading to activation of the signal transducer and activator of transcription 6 (STAT6).
IL4 is considered an important cytokine for tissue repair, counterbalancing the effects of proinflammatory type 1 cytokines, IL-4 also promotes allergic airway inflammation. Moreover, IL-4, a type 2 cytokine, mediates and regulates a variety of human host responses such as allergic, anti-parasitic, wound healing, and acute inflammation. IL-4 induces the expression of class II MHC molecules on resting B-cells, enhances both secretion and cell surface expression of IgE and IgG1 and regulates the expression of low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. IL-4 has been reported to promote resolution of neutrophil-mediated acute lung injury as well as positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4. In addition, IL-4 plays a critical role in higher functions of the normal brain, such as memory and learning.
IL-4 is implicated in several diseases, including asthma (multiple); autoimmune disease (multiple); hepatitis B; hepatitis C; and pancreatic cancer (multiple)[1][2][3][4][5][6].

Biological Activity

Measure by its ability to induce HT-2 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-4 is approximately >1x10 6 IU/mg.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

P07750 (H21-S140)

Gene ID
Molecular Construction
N-term
IL-4 (H21-S140)
Accession # P07750
His
C-term
Synonyms
rMuIL-4; BSF-1; Binetrakin; Lymphocyte stimulatory factor 1; Pitrakinra
AA Sequence

MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Molecular Weight

Approximately 14.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-4 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-4 Protein, Mouse (His)
Cat. No.:
HY-P700214AF
Quantity:
MCE Japan Authorized Agent: