Animal-Free IL-7 Protein, Mouse (His)

IL-7, a hematopoietic cytokine, regulates lymphocyte population and maintains lymphoid homeostasis. IL-7 binds to its receptor complex IL7RA and CSF2RG, activating kinases like JAK1 or JAK3 depending on the cell type. This triggers downstream signaling pathways, including PI3K/Akt/mTOR or JAK-STAT5, leading to various cellular responses. IL-7's interaction with IL7R and CSF2RG is crucial for its diverse effects. Animal-Free IL-7 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-7 protein, expressed by E. coli , with C-His labeled tag.

IL-7, a hematopoietic cytokine, plays a pivotal role in the development, expansion, and survival of both naive and memory T-cells and B-cells, thereby regulating the population of mature lymphocytes and maintaining lymphoid homeostasis. Its biological effects are mediated through a receptor complex consisting of the IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Upon binding to the receptor, IL-7 activates various kinases, such as JAK1 or JAK3, depending on the cell type, leading to the propagation of signals through downstream signaling pathways, including PI3K/Akt/mTOR or JAK-STAT5. This interaction with its receptor components IL7R and CSF2RG is central to the diverse cellular responses elicited by IL-7.

Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED₅₀ for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-7 is > 5 x 10⁶ IU/mg.

Mouse

E. coli

C-His

P10168/Q544C8/NP_032397.1 (E26-I154)

16196  [NCBI]

MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI

Approximately 15.84 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.