Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His)

The IP-10/CRG-2/CXCL10 protein is a proinflammatory cytokine that regulates immune cells, cell growth, apoptosis, and vasostatic effects. It is critical during viral infection by binding to CXCR3 to activate immune cells and migrate them to the site of infection. Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIP-10/CRG-2/CXCL10 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His) is 77 a.a., with molecular weight of ~9.47 kDa.

The IP-10/CRG-2/CXCL10 Protein is a pro-inflammatory cytokine that is involved in various processes such as chemotaxis, differentiation, and activation of immune cells, as well as the regulation of cell growth, apoptosis, and modulation of angiostatic effects. It plays a crucial role during viral infections by stimulating the activation and migration of immune cells to the infected sites. Mechanistically, it binds to the CXCR3 receptor, which activates G protein-mediated signaling and leads to the activation of the phospholipase C-dependent pathway, increased intracellular calcium production, and actin reorganization. This activation of the CXCL10/CXCR3 axis is also important in neurons in response to brain injury, as it activates microglia and directs them to the site of injury, facilitating neuronal reorganization. The IP-10/CRG-2/CXCL10 Protein can exist as a monomer, dimer, or tetramer and interacts with the CXCR3 receptor.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED₅₀ for this effect is <0.2 μg/mL

Mouse

E. coli

N-His

P17515 (I22-P98)

15945  [NCBI]

IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

Approximately 9.47 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.