Animal-Free MIF Protein, Mouse (His)

The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.Animal-Free MIF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIF protein, expressed by E.coli , with C-His labeled tag.

MIF Protein, a pro-inflammatory cytokine, plays a crucial role in the innate immune response to bacterial pathogens. Its expression at inflammatory sites suggests its involvement as a mediator in regulating macrophage function during host defense. Notably, MIF counters the anti-inflammatory activity of glucocorticoids. While it exhibits phenylpyruvate tautomerase and dopachrome tautomerase activities in vitro, the physiological substrate remains unknown. The significance of its tautomerase activity and its relevance to cytokine function remain unclear.

Mouse

E. coli

C-His

P34884 (M1-A115)

17319  [NCBI]

MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Approximately 13.31 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.