1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. Platelet Factor 4
  6. Animal-Free PF-4/CXCL4 Protein, Human (His)

Animal-Free PF-4/CXCL4 Protein, Human (His)

Cat. No.: HY-P700046AF
Handling Instructions Technical Support

The PF-4/CXCL4 protein released during platelet aggregation has a crucial impact on physiological processes. It neutralizes the anticoagulant effect of heparin with higher affinity than chondroitin 4-sulfate chains. Animal-Free PF-4/CXCL4 Protein, Human (His) is the recombinant human-derived animal-FreePF-4/CXCL4 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free PF-4/CXCL4 Protein, Human (His) is 70 a.a., with molecular weight of ~8.58 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PF-4/CXCL4 protein released during platelet aggregation has a crucial impact on physiological processes. It neutralizes the anticoagulant effect of heparin with higher affinity than chondroitin 4-sulfate chains. Animal-Free PF-4/CXCL4 Protein, Human (His) is the recombinant human-derived animal-FreePF-4/CXCL4 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free PF-4/CXCL4 Protein, Human (His) is 70 a.a., with molecular weight of ~8.58 kDa.This product is for cell culture use only.

Background

PF-4/CXCL4 protein, released during platelet aggregation, plays a pivotal role in various physiological processes. It acts to neutralize the anticoagulant effect of heparin by exhibiting a higher binding affinity to heparin compared to the chondroitin-4-sulfate chains of the carrier molecule. Furthermore, PF-4 demonstrates chemotactic properties, attracting neutrophils and monocytes, thereby contributing to immune responses. Notably, it also functions as an inhibitor of endothelial cell proliferation, with the shorter form displaying greater potency than the longer variant. Structurally, PF-4 forms a homotetramer, as evidenced by studies. Additionally, it engages with TNFAIP6 through its Link domain, emphasizing its involvement in intricate molecular interactions. This multifaceted functionality underscores the importance of PF-4/CXCL4 in regulating hemostasis, immune responses, and vascular processes.

Biological Activity

Measure by its ability to inhibit human FGF-2-induce proliferation in HUVEC cells. The ED50 for this effect is <5 μg/mL.

Species

Human

Source

E. coli

Tag

N-His

Accession

P02776 (E32-S101)

Gene ID
Molecular Construction
N-term
His
CXCL4 (E32-S101)
Accession # P02776
C-term
Synonyms
C-X-C motif chemokine 4; Oncostatin A; SCYB4
AA Sequence

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Molecular Weight

Approximately 8.58 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free PF-4/CXCL4 Protein, Human (His)
Cat. No.:
HY-P700046AF
Quantity:
MCE Japan Authorized Agent: