1. Recombinant Proteins
  2. Others
  3. Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc)

Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc)

Cat. No.: HY-P72832
Data Sheet Handling Instructions Technical Support

Apolipoprotein AI plays a key role in reverse cholesterol transport, promoting cholesterol efflux from tissues and acting as a cofactor for lecithin cholesterol acyltransferase (LCAT). It forms homodimers and participates in the SPAP complex, which is essential for sperm motility, interacting with both NAXE and CLU. Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc) is the recombinant human-derived Apolipoprotein A-I/APOA1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Apolipoprotein AI plays a key role in reverse cholesterol transport, promoting cholesterol efflux from tissues and acting as a cofactor for lecithin cholesterol acyltransferase (LCAT). It forms homodimers and participates in the SPAP complex, which is essential for sperm motility, interacting with both NAXE and CLU. Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc) is the recombinant human-derived Apolipoprotein A-I/APOA1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Apolipoprotein A-I plays a crucial role in the reverse transport of cholesterol by promoting cholesterol efflux from tissues and acting as a cofactor for lecithin cholesterol acyltransferase (LCAT). It also functions as part of the SPAP complex, activating spermatozoa motility. Apolipoprotein A-I forms homodimers and interacts with NAXE and CLU, while being a component of the SPAP complex, along with an immunoglobulin heavy chain, an immunoglobulin light chain, and albumin. Additionally, it interacts with NDRG1, SCGB3A2, and NAXE, as well as YJEFN3.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human APOA1 at 5 µg/mL (100 µL/well) can bind Human MSR (HY-P76781). The ED50 for this effect is 1.846 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human APOA1 at 5 µg/mL (100 µL/well) can bind Human MSR (HY-P76781) .The ED50 for this effect is 1.846 μg/mL.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

P02647/CAA26097.1 (D25-Q267)

Gene ID

335  [NCBI]

Molecular Construction
N-term
APOA1 (D25-Q267)
Accession # P02647
hFc
C-term
Synonyms
Apolipoprotein A-I; Apo-AI; ProapoA-I; APOA1
AA Sequence

DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Molecular Weight

Approximately 55-65 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72832
Quantity:
MCE Japan Authorized Agent: