1. Recombinant Proteins
  2. Others
  3. Apolipoprotein E/APOE2 Protein, Human (R154S, R176C, HEK293, C-His)

Apolipoprotein E/APOE2 Protein, Human (R154S, R176C, HEK293, C-His)

Cat. No.: HY-P701094
Handling Instructions Technical Support

Apolipoprotein E (APOE) plays a key role in lipoprotein-mediated lipid transport and is a core component in the production, transformation, and clearance of plasma lipoproteins. As an amphipathic molecule, APOE binds to various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, favoring HDL. Apolipoprotein E/APOE Protein, Human (R154S, R176C, HEK293, C-His) is the recombinant human-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with C-6*His labeled tag and R154S, R176C, , , mutation. The total length of Apolipoprotein E/APOE Protein, Human (R154S, R176C, HEK293, C-His) is 299 a.a., with molecular weight of 33-42 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Apolipoprotein E (APOE) plays a key role in lipoprotein-mediated lipid transport and is a core component in the production, transformation, and clearance of plasma lipoproteins. As an amphipathic molecule, APOE binds to various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, favoring HDL. Apolipoprotein E/APOE Protein, Human (R154S, R176C, HEK293, C-His) is the recombinant human-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with C-6*His labeled tag and R154S, R176C, , , mutation. The total length of Apolipoprotein E/APOE Protein, Human (R154S, R176C, HEK293, C-His) is 299 a.a., with molecular weight of 33-42 kDa.

Background

Apolipoprotein E (APOE) is a crucial player in lipoprotein-mediated lipid transport, serving as a core component of plasma lipoproteins involved in their production, conversion, and clearance. Functioning as an amphipathic molecule, APOE associates with various lipoprotein particles, including chylomicrons, chylomicron remnants, very low-density lipoproteins (VLDL), and intermediate density lipoproteins (IDL), with a preference for high-density lipoproteins (HDL). It engages with a range of cellular receptors, such as the LDL receptor (LDLR), LDL receptor-related proteins (LRP1, LRP2, and LRP8), and the very low-density lipoprotein receptor (VLDLR), facilitating cellular uptake of APOE-containing lipoprotein particles. Additionally, APOE exhibits heparin-binding activity, interacting with heparan-sulfate proteoglycans on cell surfaces, supporting the capture and receptor-mediated uptake of APOE-containing lipoproteins. APOE's main function involves mediating lipoprotein clearance through hepatocyte uptake and participating in the biosynthesis and uptake of VLDLs by peripheral tissues for triglyceride delivery and energy storage. It crucially contributes to lipid homeostasis, participating in reverse cholesterol transport and playing roles in the central nervous system, immune responses, and transcriptional regulation, notably in interactions with HCV during microbial infection.

Biological Activity

Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED50 this effect is ≤8.753 ng/mL. corresponding to a specific activity is ≥1.14×105 units/mg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P02649 (K19-H317, R154S, R176C)

Gene ID

348  [NCBI]

Molecular Construction
N-term
APOE (K19-H317, R154S, R176C)
Accession # P02649
6*His
C-term
Synonyms
Apolipoprotein E; APOE; Apo-E; APOE2
AA Sequence

KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVSLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Molecular Weight

Approximately 33-42 kDa due to the glycosylation

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, 2 mM CHAPS, 2 mM DTT, 1 mM PMSF, pH 7.4 (Normally trehalose is added as protectant before lyophilization ) or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Apolipoprotein E/APOE2 Protein, Human (R154S, R176C, HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein E/APOE2 Protein, Human (R154S, R176C, HEK293, C-His)
Cat. No.:
HY-P701094
Quantity:
MCE Japan Authorized Agent: