1. Recombinant Proteins
  2. Others
  3. Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc)

Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P78239
SDS COA Handling Instructions Technical Support

Apolipoprotein E/APOE is crucial in lipid transport and participates in the production, transformation and clearance of plasma lipoproteins. It interacts with various particles, including chylomicrons and high-density lipoproteins, and binds to cellular receptors such as LDLR and VLDLR, promoting uptake. Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc) is 293 a.a., with molecular weight of 62-66 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Apolipoprotein E/APOE is crucial in lipid transport and participates in the production, transformation and clearance of plasma lipoproteins. It interacts with various particles, including chylomicrons and high-density lipoproteins, and binds to cellular receptors such as LDLR and VLDLR, promoting uptake. Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc) is 293 a.a., with molecular weight of 62-66 kDa.

Background

APOE is an apolipoprotein that plays a crucial role in lipid transport between organs through plasma and interstitial fluids. It is a key component of plasma lipoproteins and is involved in their production, conversion, and clearance. APOE interacts with various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, with a preference for HDL. Additionally, it binds to a range of cellular receptors, such as LDL receptor/LDLR and VLDL receptor/VLDLR, facilitating the cellular uptake of APOE-containing lipoproteins. APOE also possesses heparin-binding activity and binds to heparan-sulfate proteoglycans on cell surfaces, supporting the capture and receptor-mediated uptake of APOE-containing lipoproteins. Notably, APOE forms a homotetramer and interacts functionally with ABCA1 in the biogenesis of HDLs. It may also interact with APP/A4 amyloid-beta peptide, MAPT, MAP2, and secreted SORL1 in the cerebrospinal fluid, as well as PMEL to induce fibril nucleation on intraluminal vesicles.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P08226 (E19-Q311)

Gene ID
Molecular Construction
N-term
APOE (E19-Q311)
Accession # P08226
hFc
C-term
Synonyms
Apolipoprotein E; Apo-E; APOE; apolipo E
AA Sequence

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

Molecular Weight

62-66 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution in 20 mM PB, 150 mM NaCl, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P78239
Quantity:
MCE Japan Authorized Agent: