Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc)

Apolipoprotein E/APOE is crucial in lipid transport and participates in the production, transformation and clearance of plasma lipoproteins. It interacts with various particles, including chylomicrons and high-density lipoproteins, and binds to cellular receptors such as LDLR and VLDLR, promoting uptake. Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc) is 293 a.a., with molecular weight of 62-66 kDa.

APOE is an apolipoprotein that plays a crucial role in lipid transport between organs through plasma and interstitial fluids. It is a key component of plasma lipoproteins and is involved in their production, conversion, and clearance. APOE interacts with various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, with a preference for HDL. Additionally, it binds to a range of cellular receptors, such as LDL receptor/LDLR and VLDL receptor/VLDLR, facilitating the cellular uptake of APOE-containing lipoproteins. APOE also possesses heparin-binding activity and binds to heparan-sulfate proteoglycans on cell surfaces, supporting the capture and receptor-mediated uptake of APOE-containing lipoproteins. Notably, APOE forms a homotetramer and interacts functionally with ABCA1 in the biogenesis of HDLs. It may also interact with APP/A4 amyloid-beta peptide, MAPT, MAP2, and secreted SORL1 in the cerebrospinal fluid, as well as PMEL to induce fibril nucleation on intraluminal vesicles.

Mouse

HEK293

C-hFc

P08226 (E19-Q311)

11816  [NCBI]

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

62-66 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution in 20 mM PB, 150 mM NaCl, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.