1. Recombinant Proteins
  2. Others
  3. Apolipoprotein E/APOE Protein, Rat (His)

Apolipoprotein E/APOE is essential for lipid transport and is integral to the production, transformation and clearance of plasma lipoproteins.It interacts with various particles to favor HDL and binds to receptors such as LDLR and VLDLR to promote cellular uptake.Apolipoprotein E/APOE Protein, Rat (His) is the recombinant rat-derived Apolipoprotein E/APOE protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Apolipoprotein E/APOE is essential for lipid transport and is integral to the production, transformation and clearance of plasma lipoproteins.It interacts with various particles to favor HDL and binds to receptors such as LDLR and VLDLR to promote cellular uptake.Apolipoprotein E/APOE Protein, Rat (His) is the recombinant rat-derived Apolipoprotein E/APOE protein, expressed by E.coli , with N-6*His labeled tag.

Background

APOE is a vital protein involved in the transportation of lipids between organs through plasma and interstitial fluids. It plays a crucial role in the production, conversion, and clearance of plasma lipoproteins. APOE interacts with various lipoprotein particles, such as chylomicrons, chylomicron remnants, VLDL, and IDL, with a preference for HDL. It also binds to numerous cellular receptors, including LDLR and VLDLR, facilitating the uptake of APOE-containing lipoproteins by cells. Additionally, APOE possesses heparin-binding activity and binds to heparan-sulfate proteoglycans on cell surfaces, which aids in the capture and receptor-mediated uptake of APOE-containing lipoproteins. Furthermore, APOE forms a homotetramer and may interact with ABCA1 in HDL biogenesis. It can also interact with APP/A4 amyloid-beta peptide, MAPT, MAP2, and secreted SORL1 in the cerebrospinal fluid, and with PMEL to induce fibril nucleation on intraluminal vesicles.

Species

Rat

Source

E. coli

Tag

N-6*His

Accession

P02650 (E19-Q312)

Gene ID
Molecular Construction
N-term
6*His
APOE (E19-Q312)
Accession # P02650
C-term
Synonyms
APOEApolipoprotein E; Apo-E
AA Sequence

EGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMEDLRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLEEVREQMEEVRSKMEEQTQQIRLQAEIFQARIKGWFEPLVEDMQRQWANLMEKIQASVATNSIASTTVPLENQ

Molecular Weight

45 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Apolipoprotein E/APOE Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein E/APOE Protein, Rat (His)
Cat. No.:
HY-P701096
Quantity:
MCE Japan Authorized Agent: