1. Recombinant Proteins
  2. Others
  3. Apolipoprotein E/APOE Protein, Mouse (HEK293, His)

Apolipoprotein E/APOE Protein, Mouse (HEK293, His)

Cat. No.: HY-P7532
Handling Instructions Technical Support

Apolipoprotein E Protein, Mouse (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E regulates tight junction (TJs) function by regulating PKCη activity and phosphorylation of occludin on its Thr residues in an isoform-dependent manner. Apolipoprotein E also promotes cholesterol release.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Apolipoprotein E Protein, Mouse (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E regulates tight junction (TJs) function by regulating PKCη activity and phosphorylation of occludin on its Thr residues in an isoform-dependent manner. Apolipoprotein E also promotes cholesterol release[1][2].

Background

ApoE isoform specifically inhibits lipid-particle-mediated cholesterol release from neurons. Although apoE and a lipid particle are lipid acceptors, when apoE and a lipid particle form a complex, apoE on the particle surface inhibits the lipid particle-mediated cholesterol release from cells in an apoE-concentration-dependent manner[2].

Biological Activity

Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED50 this effect is ≤41.72 ng/ml, corresponding to a specific activity is ≥2.39×104 units/mg.

  • Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED50 for this effect is 41.72 ng/ml, corresponding to a specific activity is 2.39×104 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P08226 (E19-Q311)

Gene ID
Molecular Construction
N-term
APOE (E19-Q311)
Accession # P08226
6*His
C-term
Synonyms
rMuApolipoprotein E, His; ApoE; Apolipoprotein E
AA Sequence

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQHHHHHH

Molecular Weight

Approximately 34-40 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Apolipoprotein E/APOE Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7532
Quantity:
MCE Japan Authorized Agent: