1. Recombinant Proteins
  2. Others
  3. Apolipoprotein H/APOH Protein, Human (HEK293, His)

Apolipoprotein H/APOH Protein, Human (HEK293, His)

Cat. No.: HY-P7533
Handling Instructions Technical Support

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Apolipoprotein H/APOH Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS)[1].

Background

Apolipoprotein H (ApoH), also known as β2-glycoprotein I (β2GPI), is a 43–50 kDa single-chain glycoprotein that is expressed predominantly in the liver but also in other cell types such as endothelial cells, lymphocytes, astrocytes and neurons. ApoH is a phospholipid-binding (e.g. cardiolipin) plasma protein that also binds other negatively charged molecules such as DNA and oxidised low-density lipoproteins and interacts with a variety of proteins[1].

Biological Activity

1.Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.4957 μg/mL, corresponding to a specific activity is 2.02×103 units/mg.
2.Measured by its binding ability in a functional ELISA. When Recombinant Human Apolipoprotein H/APOH is immobilized at 2 µg/mL(100 µL/well), can bind Recombinant Human LDL R. The ED50 for this effect is 0.5539 μg/mL.

  • Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.4957 μg/mL, corresponding to a specific activity is 2.02×103 units/mg.
Species

Human

Source

HEK293

Tag

C-His

Accession

P02749 (G20-C345)

Gene ID

350  [NCBI]

Molecular Construction
N-term
APOH (G20-C345)
Accession # P02749
His
C-term
Synonyms
rHuApolipoprotein H, His; ApoH; B2G1; B2GP1; Apolipoprotein H
AA Sequence

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Weight

Approximately 45-70 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.2 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Apolipoprotein H/APOH Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein H/APOH Protein, Human (HEK293, His)
Cat. No.:
HY-P7533
Quantity:
MCE Japan Authorized Agent: