1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Apoptosis inhibitor 4/Birc5 Protein, Mouse (P.pastoris, His)

Apoptosis inhibitor 4/Birc5 Protein, Mouse (P.pastoris, His)

Cat. No.: HY-P71717
Handling Instructions Technical Support

Apoptosis inhibitor 4/Birc5 has the dual effects of promoting cell proliferation and inhibiting apoptosis. As an important component of the chromosomal channel protein complex (CPC), Birc5 coordinates chromosome alignment and segregation during mitosis and cytokinesis. Apoptosis inhibitor 4/Birc5 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Apoptosis inhibitor 4/Birc5 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Apoptosis inhibitor 4/Birc5 has the dual effects of promoting cell proliferation and inhibiting apoptosis. As an important component of the chromosomal channel protein complex (CPC), Birc5 coordinates chromosome alignment and segregation during mitosis and cytokinesis. Apoptosis inhibitor 4/Birc5 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Apoptosis inhibitor 4/Birc5 protein, expressed by P. pastoris , with N-His labeled tag.

Background

Apoptosis inhibitor 4/Birc5, a versatile protein, assumes dual roles in promoting cell proliferation and thwarting apoptosis. As a crucial component of the chromosome passage protein complex (CPC), Birc5 plays an essential role in orchestrating chromosome alignment and segregation throughout mitosis and cytokinesis. It directs CPC movement, ensuring its localization shifts from the inner centromere in prometaphase to the midbody during cytokinesis, contributing to the organization of the central spindle by associating with polymerized microtubules. Birc5 is instrumental in recruiting CPC to centromeres during early mitosis, binding to histone H3 phosphorylated at 'Thr-3' (H3pT3). Functioning in concert with RAN, Birc5 aids in mitotic spindle formation, acting as a scaffold for the delivery of the RAN effector molecule TPX2 to microtubules. Additionally, it counteracts default induction of apoptosis in G2/M phase and, when acetylated, represses STAT3 transactivation of target gene promoters. Birc5 serves as an inhibitor of CASP3 and CASP7, crucial for the maintenance of mitochondrial integrity and function. Existing as a monomer in the CPC-bound state, Birc5 protects cells against apoptosis more efficiently than in its homodimeric form. It engages in a complex network of interactions with various proteins, such as histone H3, RAN, tubulin, XIAP/BIRC4, and DIABLO/SMAC, highlighting its multifaceted regulatory functions in cellular processes.

Species

Mouse

Source

P. pastoris

Tag

N-His

Accession

O70201 (M1-A140)

Gene ID
Molecular Construction
N-term
His
Birc5 (M1-A140)
Accession # O70201
C-term
Synonyms
Birc5; Api4; Iap4Baculoviral IAP repeat-containing protein 5; Apoptosis inhibitor 4; Apoptosis inhibitor survivin; TIAP
AA Sequence

MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA

Molecular Weight

Approximately 18.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Apoptosis inhibitor 4/Birc5 Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apoptosis inhibitor 4/Birc5 Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71717
Quantity:
MCE Japan Authorized Agent: