1. Recombinant Proteins
  2. Others
  3. ARL2BP Protein, Human (His)

The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (His) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 53 In-stock
10 μg USD 90 In-stock
50 μg USD 250 In-stock
100 μg USD 425 In-stock
500 μg USD 1190 In-stock
> 500 μg   Get quote  

Get it by April 10 for select sizes. Order within 23 hrs 29 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (His) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-6*His labeled tag.

Background

The ARL2BP protein, in collaboration with ARL2, assumes a pivotal role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its involvement in cellular processes. Acting potentially as an effector of ARL2, ARL2BP is found in complexes with ARL2 and SLC25A6, as well as ARL2, ARL2BP, and SLC25A4. It interacts with key transcription factors, including STAT2, STAT3, and STAT4, with an enhanced interaction with STAT3 in the presence of ARL2. Notably, ARL2BP's association with GTP-bound ARL2 and ARL3, either as the ARL2-ARL2BP complex or ARL2BP alone, binds to SLC25A4, suggesting a role in protein targeting. Additionally, the interaction with ARL2 may be crucial for the specific targeting of ARL2BP to the cilia basal body. These intricate associations underscore ARL2BP's multifaceted involvement in cellular signaling and localization processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y2Y0-1 (M1-H163)

Gene ID
Molecular Construction
N-term
6*His
ARL2BP (M1-H163)
Accession # Q9Y2Y0-1
C-term
Synonyms
ADP ribosylation factor like 2 binding protein; BART; BART1; Binder of ARF2 protein 1
AA Sequence

MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Molecular Weight

Approximately 21 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ARL2BP Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ARL2BP Protein, Human (His)
Cat. No.:
HY-P76156
Quantity:
MCE Japan Authorized Agent: