ARL2BP Protein, Human (His)

The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (His) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-6*His labeled tag.

The ARL2BP protein, in collaboration with ARL2, assumes a pivotal role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its involvement in cellular processes. Acting potentially as an effector of ARL2, ARL2BP is found in complexes with ARL2 and SLC25A6, as well as ARL2, ARL2BP, and SLC25A4. It interacts with key transcription factors, including STAT2, STAT3, and STAT4, with an enhanced interaction with STAT3 in the presence of ARL2. Notably, ARL2BP's association with GTP-bound ARL2 and ARL3, either as the ARL2-ARL2BP complex or ARL2BP alone, binds to SLC25A4, suggesting a role in protein targeting. Additionally, the interaction with ARL2 may be crucial for the specific targeting of ARL2BP to the cilia basal body. These intricate associations underscore ARL2BP's multifaceted involvement in cellular signaling and localization processes.

Human

E. coli

N-6*His

Q9Y2Y0-1 (M1-H163)

23568  [NCBI]

MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Approximately 21 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.